SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302035703|ref|YP_003796025.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302035703|ref|YP_003796025.1|
Domain Number 1 Region: 1-280
Classification Level Classification E-value
Superfamily Folate-binding domain 1.68e-96
Family Aminomethyltransferase folate-binding domain 0.000000652
Further Details:      
 
Domain Number 2 Region: 272-364
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 6.54e-24
Family Aminomethyltransferase beta-barrel domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302035703|ref|YP_003796025.1|
Sequence length 369
Comment glycine cleavage system aminomethyltransferase [Candidatus Nitrospira defluvii]
Sequence
MKQTPLIDAHRKAQGKLVDFAGWEMPIQYSGVVDEYQTVRRHAGLFDVSHMGRIRVSGPG
SLAFLQRVTTNDVSTLSVQQSHYSMICAQNGGIKDDIFVYHVKPYEFLVCVNASNREKIV
TWLHEKVEQAQGCKVQDQSASLAQIAIQGPASRDILAAAGIADLSTLKIRHCLDATLGDD
SLLVTRTGYTGELGYELYLPAERAPKVWEQLLEAGRPLSIKPAGLGARDLLRLEMAYLLY
GNDMNEETTPIEAGAEWVVKFDKGDFIGRTELLAQQAQGTARRLVAFELVEKAVPRHGFK
ILSAQTPHTEIGEVTSGNLSPLLQKGIGMGYVPPATARPGSSILIDIRGRACPAVVVKPP
FYKKPAGTP
Download sequence
Identical sequences D8PA40
WP_013246925.1.3676 gi|302035703|ref|YP_003796025.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]