SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302035779|ref|YP_003796101.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302035779|ref|YP_003796101.1|
Domain Number 1 Region: 240-510
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.15e-60
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000195
Further Details:      
 
Domain Number 2 Region: 4-85
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000245
Family Helicase DNA-binding domain 0.033
Further Details:      
 
Weak hits

Sequence:  gi|302035779|ref|YP_003796101.1|
Domain Number - Region: 79-131
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0871
Family Iron-dependent repressor protein 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302035779|ref|YP_003796101.1|
Sequence length 514
Comment phenylalanyl-tRNA synthetase subunit alpha [Candidatus Nitrospira defluvii]
Sequence
MDNLHPLESKVLLALIRQPDGPPTLDQLEASTGLEPSQLSMAVEWLLAKSLIAVHSETVA
HIASLTPIGELFFEKYAPIERVLSAAREAGQTGKRLTIQDIQVKEALEPSDVSKAVGTLK
KEGAILIVQGGCIESTGRNSATAEAMRSLLQELRSGQRELQSFSEPLRNVLQQHAVKRGN
AREPFRIDERVTRSFVLTPAGKDVADQLSRDGVAEEVSQLTPELLKEGAWRTKRFRKYTI
SLRAPRIAAGKRHPYREFLDLVKLKLVSMGFQEMRGTLVETEFWNMDALFMPQFHPARDI
HDVYFVKNPTHARTIAEPYLTQVTQVHEKGTGAGSTGWGYTFDAERAKRLVLRSQGTAVS
ARTLASGASVPGKYFSIARCFRYDQVDATHATDFFQVEGIVLGADINFRTLLGLLNLFAR
EVAQAKEVKFLPAYFPFTEPSVEMHVRHPKLGWMELGGAGLFRPEVTTPLGVSVPVIAWG
LGLDRMAMVALGIHDIRDLFSADLEFIRTMRGSF
Download sequence
Identical sequences D8PAB6
gi|302035779|ref|YP_003796101.1| WP_013247001.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]