SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302035792|ref|YP_003796114.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302035792|ref|YP_003796114.1|
Domain Number 1 Region: 19-249
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.87e-56
Family G proteins 0.0000177
Further Details:      
 
Domain Number 2 Region: 327-427
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.51e-20
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0011
Further Details:      
 
Domain Number 3 Region: 235-323
Classification Level Classification E-value
Superfamily Translation proteins 8.84e-16
Family Elongation factors 0.001
Further Details:      
 
Domain Number 4 Region: 465-608
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000856
Family Adenosine-5'phosphosulfate kinase (APS kinase) 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302035792|ref|YP_003796114.1|
Sequence length 626
Comment sulfate adenylyltransferase subunit 1, and adenylylsulfate kinase (bifunctional enzyme) [Candidatus Nitrospira defluvii]
Sequence
MNQGSIERVNHMTQHEQSKPQESLNIVIVGHVDHGKSTLVGRLYADTGSLPEGKVEKVQA
ICRQQGKEFEYAFLFDAFLEEQEQGITIDTARTFFIWNGRQYIIIDAPGHKEFLKNMISG
AARAEAALLLIDALEGVREQSKKHGYLLSLLGVTQFAVVVNKMDLVGYRQDVFDGIEKEY
REFLGQFRAVPQQMIPVSAKMGDNIATRSSHMNWYQGPTVLETLALFKKEQVRSEQPLRF
PLQDVYKFDARRILAGRITAGRLKVGDQLVFSPSNKTAVVQSLEGFNVDPPRSDAQAGES
VGITLDEQIFVERGEIASHRDSIPLVSTAIRVNLFWMGRRPLEKGRKYVLRLATREVACE
VAAIHRIIDTADLAQLQESQSVAKNQVAELTLRVKSPLAFDLSSSFEATGRFVLVDEYDI
AGGGIITELVHDEQEGLREEARQREYAWLTGDVRAEDRARQYGHRAAIVLFTGSAQTGKT
FLARRVEALLVADSRHAYLLEGENLLQGLDADLSAADPSFAAERVRRYGEVARLLIDTGL
IVVSTSKTFGINYQRMAEMIRTLVQPAPVLAVHMSRAGEEPPPNTDLHFAGPQDFDAAAR
QILDELKQRGVLIEPPGTRSTIQYSI
Download sequence
Identical sequences D8PAC9
WP_013247014.1.3676 gi|302035792|ref|YP_003796114.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]