SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302035797|ref|YP_003796119.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302035797|ref|YP_003796119.1|
Domain Number 1 Region: 65-134
Classification Level Classification E-value
Superfamily RuvA domain 2-like 3.11e-19
Family DNA helicase RuvA subunit, middle domain 0.0039
Further Details:      
 
Domain Number 2 Region: 1-63
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8e-17
Family DNA helicase RuvA subunit, N-terminal domain 0.002
Further Details:      
 
Domain Number 3 Region: 152-201
Classification Level Classification E-value
Superfamily DNA helicase RuvA subunit, C-terminal domain 0.000000109
Family DNA helicase RuvA subunit, C-terminal domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302035797|ref|YP_003796119.1|
Sequence length 202
Comment holliday junction DNA helicase RuvA [Candidatus Nitrospira defluvii]
Sequence
MIALLTGLMAFKAPSQVTLDVHGVGYEVLIPLSTYYSLPNQHESVTLSIHTHVREDAIQL
YGFLTTAEKEAFLLLTGISGIGPKLGLSVLSTLSVRDLFSAIQAGDIEKLGTVSGIGKKS
AARIALELKDKVARLYPAGEQSTSGSGQPAHPLYDDALSALVNLGYRQPDVKEALKRIEK
SGAMAQGLEGVIREALKDLAKG
Download sequence
Identical sequences D8PAD4
WP_013247019.1.3676 gi|302035797|ref|YP_003796119.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]