SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302035807|ref|YP_003796129.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302035807|ref|YP_003796129.1|
Domain Number 1 Region: 263-379
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.72e-29
Family Cold shock DNA-binding domain-like 0.0027
Further Details:      
 
Domain Number 2 Region: 197-285
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.72e-25
Family Cold shock DNA-binding domain-like 0.0017
Further Details:      
 
Domain Number 3 Region: 355-446
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.39e-24
Family Cold shock DNA-binding domain-like 0.0033
Further Details:      
 
Domain Number 4 Region: 437-540
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4e-23
Family Cold shock DNA-binding domain-like 0.0021
Further Details:      
 
Domain Number 5 Region: 23-121
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.79e-17
Family Cold shock DNA-binding domain-like 0.013
Further Details:      
 
Domain Number 6 Region: 97-182
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000157
Family Cold shock DNA-binding domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302035807|ref|YP_003796129.1|
Sequence length 571
Comment 30S ribosomal protein S1 [Candidatus Nitrospira defluvii]
Sequence
MSTVTPQSEPKLDRDALAAMYEETFRNFEEGTITEGMVVAIGKDKVVVDIGYKSEGMIPA
DQFSHEELAQLKVGDRLQVYLEECEDADGNLVLSKEKADKMKIWEELETLHKEEKSIEGK
IISRIKGGMMVDIGVKAFLPGSQIDLHPVRDLDGLVGKTFPLKIIKINHRRGNVVVSRRV
LLEETRDRRRQTTLSTLKEGQLIQGTVKNITDYGAFIDLGGIDGLLHITDMSWGRVGHPS
ELFQVSDKVEVTVLKYDRETGRISLGLKQKSADPWTGVAAKYPVGTRVRGRVVSLTDYGA
FVELEPGVEGLVHVSEMSWTHEVRHPSRVVSVGDQVEAAVLNIDPGSRKISLGMKQTAPN
PWDMIEAKYPAGTRIEGKVKSLTDFGAFVGLEEGIDGLIHISDMSWTKHIKHPSELFKKG
QKVDAVVIRIDKEKERLSLGYKQLSRDPWEEQIPNKYRVGDSITGKVSKIADFGLFIELD
GDVEGLIHISEVGLDANVRMEEKFKPGDDVTAKIIKVDRDERKIALSLRDHQMDSDRRQV
DEFHASQGGIDQTLGRAAKQSRKRNQSDSEA
Download sequence
Identical sequences D8PAE4
gi|302035807|ref|YP_003796129.1| WP_013247029.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]