SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302035901|ref|YP_003796223.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302035901|ref|YP_003796223.1|
Domain Number 1 Region: 3-249
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 3.41e-44
Family YhfI-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302035901|ref|YP_003796223.1|
Sequence length 252
Comment putative ribonuclease Z [Candidatus Nitrospira defluvii]
Sequence
MIRVTVLGSGTNVHPTRAAAGYLVQTDQTFLLDFGPRTLSNLIASGVDRHRITHILFSHF
HADHFADFIPFFFDAVIFCKYQGGTRPPLTLIGPHGTAKLMRAMMTTFPSFNRAPFRVTI
REVSDRSFRLGETGIKPGTVTHAPRLHCVGYRIEYQDHVVTYSGDSLYCDNLVRLCREAD
LAILDCSFPENRPGAGHLHAGLCGRVAQEAGINQLVLSHFYPIAERYDVCAQAGNHFSGR
IRMARDLLKLKA
Download sequence
Identical sequences D8PAN8
gi|302035901|ref|YP_003796223.1| WP_013247123.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]