SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302035959|ref|YP_003796281.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302035959|ref|YP_003796281.1|
Domain Number 1 Region: 50-109,631-988
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.62e-32
Family Patatin 0.056
Further Details:      
 
Domain Number 2 Region: 1175-1307
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000000142
Family N-acetyl transferase, NAT 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302035959|ref|YP_003796281.1|
Sequence length 1320
Comment hypothetical protein NIDE0582 [Candidatus Nitrospira defluvii]
Sequence
MTTPASQDDPLTLATILEEEAELLHGPLPKDHPVGAPEAVRTAALFRHIHACHPKRAGLC
FSGGGIRSATFGLGVLQSLARLQLLDKFDYLSTVSGGGYIGSWLTAWIHRHPQGLDGVIE
DLRVTPNTGATEAPPPVQWLRNYSNYLSPHMGFLSADSWTLVGIYLRNLHLNWMVLLPLL
MVPLLVPRWTIALAQLNTPGLTLPVWLLQAVFMVGLGLAVMALIYLHLCRPTLSEYRRNT
RWQTLERQHWFLVACLGPLITSVLFLTTAWAWFRNGGGTPEHLSLSHAMLGGVFLHTGSW
LFSVLALKRFKAFSPWLLWETAAVAATGALGGLLLRSLLIKTPDQLVVAKFAECFATFAV
PGVLAIFLLTATVFIGLASRFTEEQDREWWGRTGSWVLIVMVVWSGLSAVVAFGPGLIAW
TPKVAASLGGLSGLLTLVLGFGSRTTAQQQEERSHTTVITDFAVRSAAPLFMLCVLVALS
LGTSWQLDLFAHHYEMHLNHLTGPMQTGVGVWPDPWGHDQVLHNTPLWMLFLFTVAVALL
GLLMSGLININRFSLHAMYRNRLIRAYLGASRIQTERERSFNPFTGFDNLDNPAMGDVRF
DDVRLARWMVREVFSTDTRAQLDAFHKLTEPPSAQLQAMIAHLTQELSRSLTSKGMAKAA
EQLRVGPACRAKIAALQQPETAAGKEAITWLTTLFLNKLYDQSPRPLHLINIALNLVKGD
NLAWQQRKAQSFTISALHSGSWNLGYRRSEEYGCNHYLGQPLSLGTALAISGAAASPNMG
YHSSSAVTFLLALFNIRLGWWLGNPGRAGADTYRKASPNVSVGPLLSEAFGLTDSCHPYV
YLSDGGHFENLGLYEMVLRRCHCILVVDAGCDPQLNFEDLGNAIRKIRIDLGIDIELNLD
QIKRAADAKTSSRHHAIGMIRYDKVDANATAGTLIYLKPSLTGNEPSDVQDYAARHPSFP
HEPTSDQFFDEAQFESYRRLGEHIAQQVLRPAIQRSEQDFSSLCHALRSYWLTTPPGMRE
SFLGETDDLKDLERLLRDDPDLLRYDLEIYPELRSVFGIDPGAIAVNPRAALHTCNLQIQ
LMEQVYLAVNLEEFHTHALNRGWMNLFRRWTSAETFRLFWPTLCGMYSQQFVRFAEQHLN
LSIDEVVVLEAMGPTSDLSSLVRDLSIEWDSVPDYAETFMQALHKPLPLEEPTGDDTRRA
AWHVRLKARPSPDDSAGPGEILAVVAATRLSVAGHRLALHGWVRPAYRGLGLGHRLFRRA
IEELTAAYSGHNLIVDLGPDNPAWAGTSIRNVGWLRFYEQLGFTRDRSDPTRFQMTRILR
Download sequence
Identical sequences D8PAU6
WP_013247181.1.3676 gi|302035959|ref|YP_003796281.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]