SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036018|ref|YP_003796340.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302036018|ref|YP_003796340.1|
Domain Number 1 Region: 45-147
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000327
Family Multidrug resistance efflux transporter EmrE 0.016
Further Details:      
 
Domain Number 2 Region: 199-291
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000051
Family Multidrug resistance efflux transporter EmrE 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302036018|ref|YP_003796340.1|
Sequence length 352
Comment hypothetical protein NIDE0642 [Candidatus Nitrospira defluvii]
Sequence
MRPSTKGALCGLTAALLAGVSAPISKLFLSDVSPLHIAGLLYTGGGLGLVICEWGRRRWG
GATVDEAPLRRADLPLLSGMVCLGGMVGPILMLSGLQRLSGVFGSLLLAMEAPFTILLAV
GWFKEHLTRQEAAGAVIILLGGGLIGYAPFGPVGDLIGVLALSGATVCWALDNNLAQRLS
SLRDPLAVMKVKALSAGLVMIGIGCFSHDRWPEAMAVAALMGVGSVSYGVSLVLDAYALR
FVGAAREAAYFATAPFVGAVFSIPLLGEPWGSREVLVALLMGTGVLLLQGARHVHLHTQA
EVEHDHLHRHADLHHDHHETFGTGAHAHQHRHQPITHDHAHVSDLHHRHPHS
Download sequence
Identical sequences D8PB05
gi|302036018|ref|YP_003796340.1| WP_013247240.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]