SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036127|ref|YP_003796449.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302036127|ref|YP_003796449.1|
Domain Number 1 Region: 102-334
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 9.94e-75
Family MurCDEF 0.00013
Further Details:      
 
Domain Number 2 Region: 337-495
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 3.14e-49
Family MurCDEF C-terminal domain 0.0000543
Further Details:      
 
Domain Number 3 Region: 2-102
Classification Level Classification E-value
Superfamily MurE/MurF N-terminal domain 2.09e-22
Family MurE/MurF N-terminal domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302036127|ref|YP_003796449.1|
Sequence length 502
Comment UDP-N-acetylmuramoyl-L-alanyl-D-glutamate-2, 6-diaminopimelate ligase [Candidatus Nitrospira defluvii]
Sequence
MTLDELIGPLHGRLGVLERNGDQRVTIADLTDDSRKVGPGSLFVAVQGERVDGHQFLDRV
VAAGAAAVVVQRSGDVGAIPCVRVQDSRAALGILGSRFYGDPSSSLRMVGVTGTNGKTTT
TYVVKTMLEAARRQVGLIGTVAYLVGKESIPASHTTPGALELQKLFARMREARLDTVVME
VSSHALALDRTAGSEFDVAVFTNLTQDHLDFHLDMERYFQAKLKLFAELGRAGAVKPRKR
AIINADDPWGARIRSACTVPVWTYGLHQQADIYADGVRLSPAGTSFTLRSPAGTCPIKSR
LVGEHNVSNLLAAIGVVLHEGLTLDQVRSAVETVTNVPGRFELVEAGQDFSVVVDYAHTE
DALVRLLTAAQALRTGRIITVFGCGGDRDRTKRPKMGRAAVKYSDVVILTSDNPRTEDPA
AILREVEVGVKEALAERGHVRYRMVADRREAIEAAIREAKPGDMVLIAGKGHEDYQIVGT
TKHHFDDREVARDTIGALRSGA
Download sequence
Identical sequences D8PBB4
gi|302036127|ref|YP_003796449.1| WP_013247349.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]