SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036128|ref|YP_003796450.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302036128|ref|YP_003796450.1|
Domain Number 1 Region: 123-336
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 3.66e-59
Family MurCDEF 0.0000351
Further Details:      
 
Domain Number 2 Region: 339-475
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 9.61e-33
Family MurCDEF C-terminal domain 0.00079
Further Details:      
 
Domain Number 3 Region: 33-119
Classification Level Classification E-value
Superfamily MurE/MurF N-terminal domain 1.7e-20
Family MurE/MurF N-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302036128|ref|YP_003796450.1|
Sequence length 487
Comment UDP-N-acetylmuramoyl-tripeptide-D-alanyl-D-alanine ligase [Candidatus Nitrospira defluvii]
Sequence
MREHGNRGVMALFTVEEICEVLSVRPPAGVTPQDLKQRIRRVVTDSRSVRKGDLFIAFQG
ERFDAHTFVPKALAQGAVCAIVQEDYRLPPAPKRTGVPVLLGVRDTLEAYQRLATHYRNR
FPIPVIAITGSNGKTTTKEMVAQVVAQRWKTLKTEGNLNNRIGVPQTLFQLAPRHQAAVI
EMGVDQQGQTTRLCEIARPTIGVITNIGPDHLEFFGSMEGSAQAKAELLDHLPQDGAVVL
NADDEYFDYLAARAQCRVVAFGISPKAAIRAANIRVDEKGGTLFGLVVPGKSRQTEIRIR
AQGQHNVSNALAAAAVGYVLGLSGTAIAEGLAKFRPAAMRSQISLSHGVQVINDCYNANP
ASMKAAVQLLAELGRGKRSIAALGDMLELGTDSKRMHREVGAFLAAQGIGHLLACGVLGR
ELAEGARQAGMASDRITELPDAPAAAAALARMVRQGDVVLVKASRGMRMEQVVEAVMGMR
RVARKAC
Download sequence
Identical sequences D8PBB5
WP_013247350.1.3676 gi|302036128|ref|YP_003796450.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]