SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036130|ref|YP_003796452.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302036130|ref|YP_003796452.1|
Domain Number 1 Region: 100-320
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 1.28e-48
Family MurCDEF 0.00014
Further Details:      
 
Domain Number 2 Region: 322-460
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 1.65e-41
Family MurCDEF C-terminal domain 0.00012
Further Details:      
 
Domain Number 3 Region: 2-97
Classification Level Classification E-value
Superfamily MurCD N-terminal domain 0.000000000000107
Family MurCD N-terminal domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302036130|ref|YP_003796452.1|
Sequence length 462
Comment UDP-N-acetylmuramoylalanine-D-glutamate ligase [Candidatus Nitrospira defluvii]
Sequence
MNVKDLQVTVVGLARSGVGAARLLNHLGARVTLADRKEAQELTAILSQVDRSSIAVKVGA
QYESALEGADLVVISPGVPTHLDALNRVRARGVRVIGELELASRFLTAPVVAVTGTNGKS
TTVTLIGKFLQESGKRAFVGGNLGIAASEAALTSVQAKAGSAAPYEYVVLEVSSFQLETT
EQFHPWIAAILNVTLDHMDRYASVEDYVAAKATIFANQTAGDYSLFNLDDARVAALRGRT
KGTVLGFSRSGATVSGVAGATVLDGDLIVTTVRGRREEICRRSDMRLIGLHNVENVMAAV
TYGLLCGCSIEAVRAVLRSFPGLEHALEVVRERRGVRFVNDSKGTNVDAVLKALEGIDQP
IWLIAGGRDKGGDFSRLERAIRERVKGLILIGEAAGRIQAAMGDFDRCRPAATLRDAVEL
AAREAQPGEVVLLSPACASFDMFADYQDRGRQFKALVQGLPA
Download sequence
Identical sequences D8PBB7
WP_013247352.1.3676 gi|302036130|ref|YP_003796452.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]