SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036133|ref|YP_003796455.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302036133|ref|YP_003796455.1|
Domain Number 1 Region: 91-311
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 1.83e-66
Family MurCDEF 0.0000129
Further Details:      
 
Domain Number 2 Region: 312-457
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 1.47e-45
Family MurCDEF C-terminal domain 0.0000675
Further Details:      
 
Domain Number 3 Region: 6-92
Classification Level Classification E-value
Superfamily MurCD N-terminal domain 2.35e-28
Family MurCD N-terminal domain 0.0000825
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302036133|ref|YP_003796455.1|
Sequence length 460
Comment UDP-N-acetylmuramate-L-alanine ligase [Candidatus Nitrospira defluvii]
Sequence
MFRKTQHIHLVGIGGSGMSGIAEVLLTLGYKVSGSDLSQSETTRRLEELGGRIAIGHHES
NIGEAQVVVISSAVAATNPEVVAAKARQIPVIPRAEMLAELMRLKFGVAIAGAHGKTTTT
SMVANVLAQGGLDPTMVIGGKVNALGSHARLGRGDLLIAEADESDGSFLRLAPTIAAVTN
IDREHLDHYGSMEKLNDSFLEFVNKVPFYGLAVLCSDDERLRNLLPRVVKRYQTYGLHEH
PGHVPDFRATDISLRQWGSEFRVFFRGRNLGPFRLSIPGIHNVSNSLVAIAIGMELDIPV
DLIRKGLAAFSGVERRFHLRGEKAGIMVVDDYGHHPTEVRATIAAAKQGWDRRVVVLFQP
HRYSRSRDLMQEFAHAFDQADALFMTEIYAAGEQPIPGVSGAKLVEAVQAAGHPSATFVE
RKDTMAEQVLPTLKSGDLVITLGAGDIWKTGLAILERLPA
Download sequence
Identical sequences D8PBC0
gi|302036133|ref|YP_003796455.1| WP_013247355.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]