SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036134|ref|YP_003796456.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302036134|ref|YP_003796456.1|
Domain Number 1 Region: 33-218
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.29e-36
Family Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain 0.00025
Further Details:      
 
Domain Number 2 Region: 204-309
Classification Level Classification E-value
Superfamily Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain 4.45e-36
Family Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302036134|ref|YP_003796456.1|
Sequence length 310
Comment UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus Nitrospira defluvii]
Sequence
MSRAAGKDHAARTRKDWARILAGVRGTVTYEASLQAYTSFHIGGPAEVLVEPADVEDLCR
VVAQARAEHVPVFVVGGTNVLVRDGGIRGIVVSLRQFKAIRQEPDHVLYAEGGVGMPTLI
GYAIRRSLAGLEWGAGIPGTVAGCVVMNAGTRLGEMKDSVKAVRMVDPRGRVVDIPAADI
PFSYRRAHLPRGIVAGVWVQLRPGDHDRIEKTVKDYLQYRKQTQPLTLPSAGCVFKNPPQ
DSAGRLVDAVGLKGARIGDAQVSEKHANFMVNLGHARAADVLALIKKVRAAVKKVSGVKL
ELELKVVGEA
Download sequence
Identical sequences D8PBC1
gi|302036134|ref|YP_003796456.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]