SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036267|ref|YP_003796589.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302036267|ref|YP_003796589.1|
Domain Number 1 Region: 21-279
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 4.4e-70
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00000563
Further Details:      
 
Domain Number 2 Region: 238-363
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 9.16e-22
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302036267|ref|YP_003796589.1|
Sequence length 371
Comment putative quinol-cytochrome c reductase cytochrome b subunit [Candidatus Nitrospira defluvii]
Sequence
MDTTTQPTTTQPSAIEKVLAFVDERVGLKTLQAKMLNEPVPGGSRWAYVFGSVLLFIFIM
QAVTGILLMFYYVPTADHAYASTQYIIHSVDYGWFLLSYHFWGSTAMVVCVFAHMSQVFL
WGAYKKPRELIWLVGLALFGIVMGFGFTGYLLPWDQRAYWATTVGVEIMDKTPLLGDFMA
RFLKGGATPGQMTLSRFFVIHVMVLPAALMGLAGLHLFLFRKAGPAGPFRGSVEEIKAKT
DYFFPRQIWKDIVGMVAVFLCICSLAFWEPIVLLEEATPDPGDYHPEPEWYFLFLFQLLR
LKVFAGEFGQFLGAIALPGAFMALLAALPFIDRDPERNIFKRPIALIGWIVVMASILIFT
VAAIINREFLE
Download sequence
Identical sequences D8PBQ4
WP_013247489.1.3676 gi|302036267|ref|YP_003796589.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]