SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036307|ref|YP_003796629.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302036307|ref|YP_003796629.1|
Domain Number 1 Region: 58-194
Classification Level Classification E-value
Superfamily Sortase 2.75e-18
Family Sortase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302036307|ref|YP_003796629.1|
Sequence length 200
Comment sortase family protein, Peptidase C60 [Candidatus Nitrospira defluvii]
Sequence
MSRFRPGSRLLTILIAGLLAIGGWQVWEGSWIYAKARLAQVLLQRAWSRALTGEPMPKPW
PWADTWPVARLRMQHPSVDLIVLAGASGRTLAFGPGHVTSSALPGQEGTVMLTGHRDTHF
RFLRAVHPNDQLDLTGTDGTTLHYRIIEQRVMDSRRELIPTGQDTEDLVLVTCFPFDAIQ
AGGPLRYVVRAERVLDRGHS
Download sequence
Identical sequences D8PBU4
gi|302036307|ref|YP_003796629.1| WP_013247529.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]