SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036341|ref|YP_003796663.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302036341|ref|YP_003796663.1|
Domain Number 1 Region: 98-376
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.63e-68
Family RecA protein-like (ATPase-domain) 0.0000000298
Further Details:      
 
Domain Number 2 Region: 57-133
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.31e-30
Family Cold shock DNA-binding domain-like 0.0000374
Further Details:      
 
Domain Number 3 Region: 9-55
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00000000000204
Family Rho termination factor, N-terminal domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302036341|ref|YP_003796663.1|
Sequence length 423
Comment transcription termination factor Rho [Candidatus Nitrospira defluvii]
Sequence
MTQVKGEVMHLAELKQKSIADLNEVARDLKIEGAANLRKQELIFAILQAQTEKNGVVFGE
GVLETLPDGFGFLRAPDSNYLPGPDDIYISPSQIRRFNLRTGDIVSGQIRPPKESERYFA
LLKVEKVNYEDPEVARDKILFDNLTPLYPEERLNLEFDREEYCTRVMDLTTPIGKGQRGL
IVAAPRTGKTMLLQAIARAILKNHKEVTLIVLLIDERPEEVTDWQRQVKAEVISSTFDEP
AQRHAQVAEMVLEKAKRLVEHKKDVVILLDSITRLARAYNTIAPPSGKVLSGGLDSNALQ
RPKRFFGAARNIENGGSLTIMATALIDTGSRMDDVIFEEFKGTGNMEVHLDRRLADKRLF
PAIDISQSGTRKEELLVDRDRLNKMWILRKVLSPLGTMEAMEFLMDKIGGTKTNQEFLQS
MNR
Download sequence
Identical sequences D8PBX8
gi|302036341|ref|YP_003796663.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]