SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036383|ref|YP_003796705.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302036383|ref|YP_003796705.1|
Domain Number 1 Region: 39-142
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.8e-17
Family Cold shock DNA-binding domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302036383|ref|YP_003796705.1|
Sequence length 503
Comment ribonuclease G [Candidatus Nitrospira defluvii]
Sequence
MGVEIAISIAREETRVAVLDNGVVTDLYGDRAKDQDFVGNIYKGRVAKVLPGMQAAFIDI
GLEKAAFMHVSDLSMDVEPGDTLVEGDDDDNKDSEVPKPKRQSSKPIEELLSEGQEVMVQ
ISKGPIGTKGSRVTTYVSLPGRYLVFMPTVEHIGVSRRIPRDEERARLKEIMKRARRPGF
GYIVRTVSEGVKEEELRSDVEFLHVLWQDVLTKRDQQPAPSLLHSDLSLSFRVVRDLFGR
RVDRLLIDSREEYNAIKGFVQRFSPEQTSRIHFYDKEESLFDYLGVEQEIARAMSRKVWL
KSGGYLVIDHTEAMTVIDVNTGRFVGKRDQEETILRNNLEAAREIAYQVKLRGIGGIIIV
DFIDMEREKNRDKVYHALVDAMSSDKARTRISRVSDLGLIEISRERVREDLLRSLSEPCH
YCDGRGYTKSPMSVAYEIFREVRRLGHEIEQQRVVVGAHPAVALLLQEQEQPGVEELERR
YSAKILVTPDDRLHLEQFDLVVM
Download sequence
Identical sequences D8PC20
WP_013247605.1.3676 gi|302036383|ref|YP_003796705.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]