SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036423|ref|YP_003796745.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302036423|ref|YP_003796745.1|
Domain Number 1 Region: 1-279
Classification Level Classification E-value
Superfamily Folate-binding domain 1.26e-77
Family Aminomethyltransferase folate-binding domain 0.0000666
Further Details:      
 
Domain Number 2 Region: 283-361
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 6.54e-16
Family Aminomethyltransferase beta-barrel domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302036423|ref|YP_003796745.1|
Sequence length 363
Comment putative aminomethyltransferase [Candidatus Nitrospira defluvii]
Sequence
MKQSRLDDQHQQLGAIFEDTAGWSMPTHYGDPAAEYAAVRGAVGLSDLSHRGKIRVTGDD
RIKWLQSIISNDILPLQPGQGRYSSFLTHKGKMLGYFRVYVSADAVWVEDVGEVGDATFQ
ALRKFLLYGTKAKMENCGESWGLLLVSGPKSAEAVAAAFGIEVRALQLLHTLPATIDGQQ
ALILRTEETGEQDFEVLLPADAVPAAWNQLMTSGAPFGIKPVGTQARELLRIEAGLPKAG
PDLNEEIVPPEANLEGKAFSLSKGCYPGQEVVARMDTYGNVRRHLVGLIIQDKAVPPAGS
KLFSGDREVGWVSSAVFSPQRNAVLAFGFPLRDFSSPDTTLTVEVAGTRHSAAVHALPFQ
KHS
Download sequence
Identical sequences D8PC60
WP_013247645.1.3676 gi|302036423|ref|YP_003796745.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]