SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036471|ref|YP_003796793.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302036471|ref|YP_003796793.1|
Domain Number 1 Region: 298-534
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.75e-31
Family ABC transporter ATPase domain-like 0.00045
Further Details:      
 
Domain Number 2 Region: 72-292
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 3.14e-18
Family DNA repair protein MutS, domain III 0.01
Further Details:      
 
Domain Number 3 Region: 734-809
Classification Level Classification E-value
Superfamily SMR domain-like 0.000000719
Family Smr domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302036471|ref|YP_003796793.1|
Sequence length 810
Comment MutS2 family protein [Candidatus Nitrospira defluvii]
Sequence
MQSETLQSESCNVLEWATLLDHLASYAQSAIGTERCRSLVLEINLSQAQMRQQETSDMLR
LRSGADPFPVLRFPNVAEWLGRVAKGACLEVHELRDIALVLGLIDDVQRYLLRHQADAPA
VCAMAVQLGPIEEYRRLTIALNAAIDPDGSMRESASPELHRLMHRAKDLKQQMRHRLDQI
LHSRRYEEVLQEHYFAQREGRYVVPIKAEMQGRIPGIVHDISSSGATVFLEPRELVDLNN
SIKVVDLDIEREVRRILRELSAMVAPHQPALAGSVAVLGELDAISAKAGLSQRLQAAPPR
LNEQGRILLNRARHPFLVLTKEQVVPNDLVFDETVRVLIISGPNTGGKTVTLKLLGLFAL
MVRCGLHLPCAPESEMAIFPSVYADIGDAQDLARDLSSFSAHITQMVQLLKEVSEGTDPG
TSPSPIHPGRALVLLDEPVTSTDPAEGAALASALLCRLAAAGVKVVATTHYSLLKGLAQE
TSGFANASVEFNIDTLSPTYRLIQGQPGGSAAIEIAGRLGMDESLLQDARARLQGDNRLL
ETLLNDLQDKQRRMSEDQAAATLARQTAEQAARESQELLTYLQESERDERQGLKKKLSQE
FQRARAAVQATLDDLKRDQKLLKAKETKVRLIELEQAAGREVGAAQEPIPVDRLSVGAAV
EVVGLGMTGTLLESPQGKKRVRLKVGEGEILANVGSLVGLARLPQPARSEPRKTTAVTYR
RTSQTLAPEDIQETLDVRGQAADDALDIVVAGLDRAILGGSPFVRIIHGHGTGRLRVVLR
DYLKASPYVVSFRPGDRAEGGDGVTIVELR
Download sequence
Identical sequences D8PCA8
gi|302036471|ref|YP_003796793.1| WP_013247693.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]