SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036547|ref|YP_003796869.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302036547|ref|YP_003796869.1|
Domain Number 1 Region: 392-599
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.26e-29
Family ABC transporter ATPase domain-like 0.00031
Further Details:      
 
Domain Number 2 Region: 117-371
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0000000209
Family DNA repair protein MutS, domain III 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302036547|ref|YP_003796869.1|
Sequence length 608
Comment putative DNA mismatch repair protein, MutS family [Candidatus Nitrospira defluvii]
Sequence
MLRRAAQLETNARRSSAGFTRWRLTIFAVGLFGSIIPHKLGWTQLGNVILAFSCMLFLIV
AWYHNRLEDRLHRLRRWQGIKQVHLARMRLGWAEIPFRPVSVPERHGYATDLDLAGPHSL
LHLINNTISSQGQERLASWLFDQPPTPASWASRQALIRELAPLALLRDRLSLEAQAVEDA
DIDGRRLLAVLQKRVDSPSFMPMLLTETFLALATAGLMLADLLSGIGNYWMLSFGLYAFL
FLSVRSRSEEIFDHAQSLHRQLERLSAVLGYLERRSYHATPRLAELCRPLLQQHTRPSTS
LKQAASLMNRLSVRAHPLVHYLINAFGPWDLYHTYRLQHLQDRIAAVAPQWFELLAELDA
AASLATFAYLHPDYPWPSLQQPDDAAHRNGAGPILDAQGLAHPLIPAKARVANHIVFQER
GRMFLVTGSNMSGKSTFLRTIGINTCLAQAGGPVCATSFRWSLVRIASCIRVDDSLDGGL
SFFYAEVKRLKKILDSTRDLEGPPVLWLIDEVFKGTNNRERLIGGRALIAALAGGNGFGL
VTTHDLELSELERRLPTVTNVHFQETVAEGALHFDYRLKPGPCPTTNALRIMALEGLPVD
SPPSTTSR
Download sequence
Identical sequences D8PCI4
gi|302036547|ref|YP_003796869.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]