SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036552|ref|YP_003796874.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302036552|ref|YP_003796874.1|
Domain Number 1 Region: 498-597
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000241
Family Fibronectin type III 0.0016
Further Details:      
 
Weak hits

Sequence:  gi|302036552|ref|YP_003796874.1|
Domain Number - Region: 75-160
Classification Level Classification E-value
Superfamily Cadherin-like 0.0746
Family Cadherin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302036552|ref|YP_003796874.1|
Sequence length 604
Comment hypothetical protein NIDE1191 [Candidatus Nitrospira defluvii]
Sequence
MKTSTSVLVMGAVGCLSSALLQTGGASYAVAADSATTMSLLQQPSLAAAVTKAQGSGTAP
ILPNPAALVLTAQKGNTAVGTLTLKKSSTDQHTYYLSTNQSWIWMNPPYGSTQSITSEAD
QLVITAQTANLPTGTHSAVVYVVDSGPNNFTNMLRIPVTLTVTASPVATPPPPPPAAPSA
VTPPQPKPVVLTPPPPPAPVAVPPPPAPAPPAPPVVSGTGMVATPVALMLTAAKGQPAVG
TLALRKGGTAQHTYSLSTNQSWIWMNPPYGSTQSITTETDQLVITAQTAALPAGTHSAVI
YIVESGPNNFSNMLRIPVTLTVTASPVATPPPPPPAAPSAVTPPAPKPVVQTPPPPPPAP
VAVPPPPAPAPPAPSPVATGPIQASPSSLALTSANAVGTLSLRKTGTDQHIYSLSTSQGW
VWLNPPYGSTQTISTETDQIVVTAKPTGLAAGTYSAVVYIVESGPNNFSNTLRIPVTFTI
AAGQTAAAAPSAPTQSAVTAPPPPPPTPPSPLPVATTPSSTAPKTASATVSWNANTESDL
AGYRIYVGTRSGSYGFAGPFEVTSRTSFTIQNLPVGATYFFSVSAFDKSGNESAKSAEVS
KSLF
Download sequence
Identical sequences D8PCI9
WP_013247774.1.3676 gi|302036552|ref|YP_003796874.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]