SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036662|ref|YP_003796984.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302036662|ref|YP_003796984.1|
Domain Number 1 Region: 6-281
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.47e-109
Family G proteins 0.0000000102
Further Details:      
 
Domain Number 2 Region: 478-598
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.15e-44
Family Translational machinery components 0.0000105
Further Details:      
 
Domain Number 3 Region: 264-403
Classification Level Classification E-value
Superfamily Translation proteins 8.33e-35
Family Elongation factors 0.00007
Further Details:      
 
Domain Number 4 Region: 602-689
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 6.23e-30
Family EF-G/eEF-2 domains III and V 0.00012
Further Details:      
 
Domain Number 5 Region: 403-480
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.47e-24
Family EF-G/eEF-2 domains III and V 0.0000337
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302036662|ref|YP_003796984.1|
Sequence length 693
Comment elongation factor G [Candidatus Nitrospira defluvii]
Sequence
MARQTPLERTRNIGIMAHIDAGKTTTTERILYYTGMTHKMGEVHEGAATMDWMEQERERG
ITITAAATTCFWREHRINIIDTPGHVDFTIEVERSLRVLDGAVAAFDSVQGVEPQSETVW
RQADKYEVPRIAFMNKMDRIGADFYASVQSIIDRLGANPVPIQIPIGREAEFRGSVDLIS
MKGYFYDDETLGAKYKIGEIPADMVDQANEYRQKMLDAVAEFDDQVMEKYINGQPLSEEE
VRRVVRAGTIAMKVVPVLCGSAFKNKGVQQLLDGVVDFLPSPVDIPPVIGVDPNTSKEVE
RSPSDSEPFSALAFKIMTDPFAGQLTFFRVYSGTLKTGTPVLNVTKGTKDRVGRLLKMHA
NKREEIDIVYAGDIAAAVGLKSATTGDTLADEKQPVLLEIMKFPEPVIAMAIEPKTKPDQ
EKMGFALQKLAQEDPSFRVRTDEETAQTIIAGMGELHLEIIVDRLMREFKVEANVGKPEV
AFRETIRRKAEAESKYIKQTGGRGQYGHVVMTVEPSEPGKGLEFINKTVGGSIPKEYIPA
IEKGVKERMETGVVAGFPLRDVKVTVIDGSYHDVDSNEMAFKIAASMGFADACKKADPVL
LEPIMKVEVLVPQDFMGDVIGNLNGRRGKVQGMKVRAGAQAIEATVPLMEMFGYATDLRS
RTQGRATYSMEFDRYDQVPRQIAEAITAKHRGE
Download sequence
Identical sequences D8PCU9
WP_013247884.1.3676 gi|302036662|ref|YP_003796984.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]