SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036693|ref|YP_003797015.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302036693|ref|YP_003797015.1|
Domain Number 1 Region: 55-176
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 1.57e-40
Family Insert subdomain of RNA polymerase alpha subunit 0.0000542
Further Details:      
 
Domain Number 2 Region: 14-55,177-231
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 9.62e-29
Family RNA polymerase alpha subunit dimerisation domain 0.001
Further Details:      
 
Domain Number 3 Region: 252-322
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 1.96e-26
Family C-terminal domain of RNA polymerase alpha subunit 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302036693|ref|YP_003797015.1|
Sequence length 333
Comment DNA-directed RNA polymerase subunit alpha [Candidatus Nitrospira defluvii]
Sequence
MIKAMKDFQIPMRVEVDKDTLSPTFGRFTTEAFERGFGTTVGNSLRRVLLSSLTGAAVTT
VKIEGVLHEFSTIPGVTEDVTSIILNVKSLRLALQGDKPKTIRLKKKGPGEAKGSDITHD
GDVTILTPDLHIATLDKDASLDLEMTIKHGRGFVPAERNKEEGLPIGVIAVDSIFSPIKR
VNFHVENARVGRMTDYDKLTLEIWTDGTISPRDALSNAAGILREHLDIFINPEERSDAKP
AAGSEDLSDEVNKNLYRSVNELELSVRAANCLKNANIKTIADLVQKTEAEMLKTKNFGKK
SLNEIKEILTEMGLSLGMKVDALPSGDAGVRSE
Download sequence
Identical sequences A0A1W1HRE6 D8PCY0
WP_013247914.1.3676 WP_013247914.1.96234 gi|302036693|ref|YP_003797015.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]