SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036737|ref|YP_003797059.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302036737|ref|YP_003797059.1|
Domain Number 1 Region: 3-204
Classification Level Classification E-value
Superfamily YrdC/RibB 2.52e-84
Family 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB 0.000000915
Further Details:      
 
Domain Number 2 Region: 207-377
Classification Level Classification E-value
Superfamily RibA-like 5.23e-71
Family RibA-like 0.00000273
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302036737|ref|YP_003797059.1|
Sequence length 402
Comment riboflavin biosynthesis protein RibBA [Candidatus Nitrospira defluvii]
Sequence
MATPFNSIEDAIKDIKKGKFIILVDDEDRENEGDLVMAAGKVTPHAVNFMAKHARGLICL
ALTPERVEELQLTPQAAENTATFGTAFTVSIDARKGITTGISAADRATTIHVAIDPRSTP
ADLARPGHIFPLKSQVGGVLRRAGQTEGSVDLARLAGLYPAGVICEIMNEDGTMARVPEL
NKFAKRHKLKMVTIKALIEYRMHRETFVRRAASALLPTTFGDFEAIAFENDIDGATHIAL
VKGRVDAETPMLVRVHSGCLTADVLGSLRCDCREQLHRAMEIIQKDGRGVLLYLNQEGRG
IGLLNKIRAYGLQDSGSDTVEANLQLGFKADLRDYGVGAQILVQLGLHRIRLITNNPRKI
VGIEGYGLKVVERVPIEIAPRADNEKYLRTKKAKLGHLLKKV
Download sequence
Identical sequences D8PD24
WP_013247958.1.3676 gi|302036737|ref|YP_003797059.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]