SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036754|ref|YP_003797076.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302036754|ref|YP_003797076.1|
Domain Number 1 Region: 2-196
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 7.63e-31
Family Ava3068-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302036754|ref|YP_003797076.1|
Sequence length 198
Comment hypothetical protein NIDE1401 [Candidatus Nitrospira defluvii]
Sequence
MKQLLPGIWQWSWFSEDKQLDFNGLFLNVGEHKILVDPPPMTAEAHTFIRRQGALDYIIV
TNRDHVREAASYQADFRCQLQVPEADVAQMNLAPSKTFKDGELLPGGIWVIHLNDQKSAG
ESALYIQQGKGVLIVGDALIGKPAGSLSLLDPEKYGDITKARDGLRRLLKYNFDSILVGD
GVSIVFGAKQAVEQALQT
Download sequence
Identical sequences B3U4J0
WP_013247975.1.3676 gi|302036754|ref|YP_003797076.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]