SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036761|ref|YP_003797083.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302036761|ref|YP_003797083.1|
Domain Number 1 Region: 350-582
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.1e-55
Family Tandem AAA-ATPase domain 0.000003
Further Details:      
 
Domain Number 2 Region: 521-729
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.67e-40
Family Tandem AAA-ATPase domain 0.0000151
Further Details:      
 
Domain Number 3 Region: 133-305
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.67e-36
Family RecG "wedge" domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302036761|ref|YP_003797083.1|
Sequence length 846
Comment ATP-dependent DNA helicase [Candidatus Nitrospira defluvii]
Sequence
MPRPESADSHDPFQAFLHRVTRPIQFACRDAYAHLPTVRNLDRFVSEQVINTLGERVYPR
AMEMDLLSLRNLFVDFHTRLTRIEQQDRLTKALALLSRLQGDARAVSQPAGPSKENQVHP
PPVRSSPARPLWELSIQYAKGVGPKRTLLLERLGAHTVEQALWTLPWRYEDRSVITPVAE
LVPGATRSVCGVITRTEATRARVRRLSILDVAVQDATGTVHAVFFNQPYLEDVLKEGLRV
MMSGRVAAGRGGWTEVRLEATQFEVLGGGEDELLHVGRIVSIYHETKGWTSRQMRILMQG
LLAEYGADMEEVLPLSVRARHRLPPIGEAIQQVHFPLPKTDLTALDQGVTSAHRRLVFEE
LLLLQAAIVLRQREMKEEPKAFRFNPHVSQLKQLAKVLPFALTSAQERVFHEIQADMVSS
RPMNRLVQGDVGSGKTVVALHALVMACGSGCQTALMVPTEILAEQHYLNLAPLLEAVGLK
AVLLTSGGKAKDRNETLKQLESGAAQVAIGTHALIQKKVRFARLGLVIVDEQHKFGVLQR
KTLLEKGYRPDVLVMTATPIPRTLAMTVYGDLDVSVIDMLPPGRKPVRTLLYTDGQRHKT
WQLVGDELKAGRQVYIVYPLVEESEKVDLKAAIQGAEHLQREIFPQARVGLLHGRLPTAE
KERTMAAFKAGTIQVLVATTVIEVGVDVPNATVMVIEHAERFGLAQLHQLRGRVGRGAQQ
SLCILMATYLAREARARVSRDGRPEENVSGAQQRLAALVNSNDGFVIAEEDLRIRGPGEF
LGLRQWGVPEFRAANLVRDAQLLEQARQEAVALLEQDPGLTLPQHQAFKAAMFRRWRGKL
ALGDVS
Download sequence
Identical sequences B3U4J7
WP_013247982.1.3676 gi|302036761|ref|YP_003797083.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]