SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036773|ref|YP_003797095.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302036773|ref|YP_003797095.1|
Domain Number 1 Region: 164-441
Classification Level Classification E-value
Superfamily NHL repeat 3.66e-55
Family NHL repeat 0.0000588
Further Details:      
 
Domain Number 2 Region: 684-960
Classification Level Classification E-value
Superfamily NHL repeat 1.2e-46
Family NHL repeat 0.000076
Further Details:      
 
Domain Number 3 Region: 36-148
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000811
Family Fibronectin type III 0.0072
Further Details:      
 
Domain Number 4 Region: 463-547
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000146
Family Fibronectin type III 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302036773|ref|YP_003797095.1|
Sequence length 989
Comment hypothetical protein NIDE1420 [Candidatus Nitrospira defluvii]
Sequence
MIKAWLLDEMFRFDRRYLTAEGSQSEWGAGDSVAEEEDLPPAPTGVAAKAGNGRVMITWD
AVPEAMYYNLYFMTTKGVQIKFSELTRPIASAEDFKTVIGVTKEKGTCIEGAQSPFMHDD
LANGTCYHYVVTVVTQKGESPESQEVMAIPAPYLIAKVIGQEGVEDGEFSSPTGIAVDKD
GNIYVADTDNHSIQKFDKDGKFLGRWGGEAGSAEGGFYYPRGLTTNSDGQVYVADTGNNR
VQRFDTDGNPMKAWGKFGFAWRGADMNKFDAPWGVTTDQDGNIYVTDTNNARIQKFKGDG
TPLLKWGRDGSFDGAFFFPRGVAVDFVGNTYVADEGNNRIQKFDTRGSFLTKWGREGSGP
GQFKAPWGVTCDALGNVYVVDQGNHRIQKFDGNGTFLCAWGNRGKTEGQLNFPSGVAVDK
EGAVYVVDSGNHRVIKYVPTDEELDRGKAERERAQAVSEYPIPRNLAIKPGDTETFLSWM
DVPGAVSYNLYFHTSANLTQEGGTKIEGVTSPYNHSGLTNDQAYYYALTAVYEDGTESGL
SDEVSATPVLIDITAPQTPYAVINHGAFMTNSPEIVVTISATDLDTGVAAYYISENPMTP
MAGTPGWVEVPPAIKFGATIPFILSPGDGQKTVIVWFKDLGNNISTPASATILVNTSGYL
CVSKWGKPGRGASLLHGGEFMAPMYGLAIDQQGSIFVVDNGNNRIQKFDRTGNFIILWGN
FGAANANFHNPTGIACDAKGDVYVVDTNNHRVQKFDGKLGGYLMKFGSRGNGEGQFNAPW
GIAIDRVRGYIYVVDSANFRVQKFDMSGEFIMSWGSFGNGDGQFYFPRGIAVDQADGTVY
VVDMGNHRVQKFDTSTNVLPQLLTKWGGSSEAGHASSPLAQEAGQLRSPWGIAVDGQGDV
YVTDTGNHRVEKFDREGNFIAQWGGFGGGDGQFNFPYGIVVDSRGSVFAVDSGNTRVQQF
MPADEGSERLQEEAEAAAELGQVDKTTRV
Download sequence
Identical sequences B3U4K9
gi|302036773|ref|YP_003797095.1| WP_013247994.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]