SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036777|ref|YP_003797099.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302036777|ref|YP_003797099.1|
Domain Number 1 Region: 116-297,424-583
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.4e-105
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000327
Further Details:      
 
Domain Number 2 Region: 294-419
Classification Level Classification E-value
Superfamily GAD domain-like 5.56e-34
Family GAD domain 0.00024
Further Details:      
 
Domain Number 3 Region: 3-108
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.67e-32
Family Anticodon-binding domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302036777|ref|YP_003797099.1|
Sequence length 587
Comment aspartyl-tRNA synthetase [Candidatus Nitrospira defluvii]
Sequence
MKIRTHRCGELTKAQVGQQVVLNGWVQRRRDHGMVLFIDLRDRTGLTQVVFNAERNAAVH
EAAHTLRSECVVSVTGQVMARPDESKNPNLPTGEIEVFADAVEILNEAKTPPFMIEDDIE
ITESLRLKYRYLDLRRPRMQRLLGLRHGIMQAVRTFLNAEQFLEVETPVLTKSTPEGARD
YLVPSRVNPGMFYALPQSPQLFKQVLMVSGVDRYYQIARCFRDEDLRNDRQPEFTQIDLE
MSFVDREQVMSLMERMIVSVFKDAGGVQLPTPFPRMTYADAMGRYGSDKPDLRFDLPLHD
VTAFAAKSDFKVFKEAATKGGLVKALVVSGGASIARSRIDALGETAKSFGAKGLAWLKIT
ADGQLESVIAKFLDAKAFAEALPEAKPGDLVLFGADKPAIVHDVLGRIRLLLGEELNLID
KTAWKPLWVTEFPLLDYSPEEKRYIFMHNPFAAPMDEDLPFLDTEPLRARAKAYDMVLNG
SEIGGGSIRNHRSDIQFRILDLLGIGKEQAQAKFGFLLEALEYGAPPHGGIAFGLDRLIM
LLGGADSIRDVIAFPKTQRAQCPLTEAPSGVSADQLKELRIKLDLVE
Download sequence
Identical sequences B3U4L4
gi|302036777|ref|YP_003797099.1| WP_013247998.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]