SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036800|ref|YP_003797122.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|302036800|ref|YP_003797122.1|
Domain Number - Region: 6-46
Classification Level Classification E-value
Superfamily Magnesium transport protein CorA, transmembrane region 0.00536
Family Magnesium transport protein CorA, transmembrane region 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302036800|ref|YP_003797122.1|
Sequence length 55
Comment hypothetical protein NIDE1454 [Candidatus Nitrospira defluvii]
Sequence
MLHASLIVLVLGLVVWGLNWTGLAEMPTQVYWVFTVGGMLLLLIHVATRRPVRVW
Download sequence
Identical sequences B3U4N7
gi|302036800|ref|YP_003797122.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]