SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036852|ref|YP_003797174.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302036852|ref|YP_003797174.1|
Domain Number 1 Region: 1-212,378-448
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.62e-98
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00077
Further Details:      
 
Domain Number 2 Region: 194-360
Classification Level Classification E-value
Superfamily YbaK/ProRS associated domain 1.03e-32
Family YbaK/ProRS associated domain 0.0015
Further Details:      
 
Domain Number 3 Region: 434-540
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.78e-30
Family Anticodon-binding domain of Class II aaRS 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302036852|ref|YP_003797174.1|
Sequence length 543
Comment prolyl-tRNA synthetase [Candidatus Nitrospira defluvii]
Sequence
MLRAGLIRKVAAGIYTYLPLGLRVLRKIERIVREEMNRAGAQELLMPVASPAELWRETGR
WDFYGKELLRFKDRHERDFCLGPTHEEVITDLFRREVRSYRQMPLNFYQIQTKFRDEIRP
RFGLMRGREFIMKDAYSFDRDEAGARLNYQKMYDAYNRIFTRCGLTFRPVEADTGLIGGT
SSHEFMVLAETGEETIVYSEDGTYAANVERAEVLPPDTADTSAQRPLAPVSTPNRRTVEE
VTAFLKIEPRQLVKTLLYSSGKETVAVLVRGDHDVNEIKVKRLLGVPEIELLKPELVPGL
TGAPVGFVGPVGLKQVRIIGDWAVKAMANFVVGANQADTHFVDANWERDFKVDQFADLRN
ARAGDSSPRKDGTLKTAKGIEVGHVFMLGTKYSQAMKATFLDAQGQEQLAVMGCYGIGVS
RTAAASVEQNHDAKGIKWPVPIAPFHVTLLPLSQSQPVTQLAETLYRAMQEAGIEVLWDD
RDERAGVKFNDADLIGAPYHLVIGEKGLAQGQVELKLRHTGETQKVAPDQVVALLSSFLK
AAS
Download sequence
Identical sequences B3U4T8
gi|302036852|ref|YP_003797174.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]