SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036859|ref|YP_003797181.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302036859|ref|YP_003797181.1|
Domain Number 1 Region: 24-183
Classification Level Classification E-value
Superfamily PEBP-like 2.49e-52
Family Prokaryotic PEBP-like proteins 0.00000506
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302036859|ref|YP_003797181.1|
Sequence length 184
Comment putative Kinase inhibitor YbcL [Candidatus Nitrospira defluvii]
Sequence
MRRLMVSMICALLVVPAIGRAGEFQVTSPTIKDQSTIGNEHVFNGFGCTGGNVSPELRWD
HAPKDTKSFAVTVYDPDAPTGSGWWHWLIFNIAPSVMHLPAGAGQPESAGAPQGSIQSMT
DFGQPGFGGPCPPPGDKPHRYIFTVFALKVDQLPLKKEASGAMVGYYLNQNAIGKASFTG
TYGR
Download sequence
Identical sequences B3U4U5
WP_013248080.1.3676 gi|302036859|ref|YP_003797181.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]