SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036861|ref|YP_003797183.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302036861|ref|YP_003797183.1|
Domain Number 1 Region: 6-186
Classification Level Classification E-value
Superfamily Uracil-DNA glycosylase-like 8.83e-60
Family Mug-like 0.0000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302036861|ref|YP_003797183.1|
Sequence length 223
Comment uracil-DNA glycosylase [Candidatus Nitrospira defluvii]
Sequence
MSSSPTTLQELAESLHNCQRCPLAKLGRHQVVFGVGNPHASVMFVGEAPGFHEDQKGEPF
VGAAGQLLNDLLESAGLSRADIYIANVIKCRPPNNRDPEPQEVETCKPFLLQQIAMIRPK
LVCSLGNWATQTLLERKVGITRVRGQAFYLKEFVLFPLLHPAAALHQGTMLQPLREDFQK
LKEFLDRHSQPPATQEGAVSSPTGTLQIDPPATTAQQMDLFGS
Download sequence
Identical sequences B3U4U7
WP_013248082.1.3676 gi|302036861|ref|YP_003797183.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]