SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036969|ref|YP_003797291.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302036969|ref|YP_003797291.1|
Domain Number 1 Region: 1-280
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.36e-131
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000594
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302036969|ref|YP_003797291.1|
Sequence length 306
Comment glycyl-tRNA synthetase subunit alpha [Candidatus Nitrospira defluvii]
Sequence
MNFQDLILTLHRFWADRGCVVHQPYDLEMGAGTFHPATFLRSLGPEPWRAAYPQACRRPT
DGRYGENPNRMQHYYQYQVVLKPAPDNIQGLYLESLKQLGIDPKKHDIRFVQDDWESPTL
GAWGLGWEVRLDGMEITQFTYFQEIGGIPLNPITGEITYGTERIAMYLQQVDNVYDLAWT
DGVSYGDVHHRSEVEFSRYNFEEGEVPMLMATFQAFEGECQRLLDKKLTLPAYDYCIKTS
HMFNLLDARGAISVTERTSYIARVRALARRCAESYLADREAMGHPLIKQSAQTGKRTGVH
SPVPTK
Download sequence
Identical sequences D8PDQ7
WP_013248190.1.3676 gi|302036969|ref|YP_003797291.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]