SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302037043|ref|YP_003797365.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302037043|ref|YP_003797365.1|
Domain Number 1 Region: 4-243
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.47e-103
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000402
Further Details:      
 
Domain Number 2 Region: 244-460
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 6.15e-63
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00000223
Further Details:      
 
Domain Number 3 Region: 553-708
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.35e-47
Family AlaX-like 0.038
Further Details:      
 
Domain Number 4 Region: 454-552
Classification Level Classification E-value
Superfamily Translation proteins 3.3e-16
Family AlaX-M N-terminal domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302037043|ref|YP_003797365.1|
Sequence length 876
Comment alanyl-tRNA synthetase [Candidatus Nitrospira defluvii]
Sequence
MSQSVNDLRRAFIQYFEQQGHRAVPSAPLIPQADPTLLFTNAGMNQFKRVFLGEETRAYN
RAVTVQKCLRAGGKHNDLENVGYTRRHHTFFEMLGNFSFGDYFKEEAIRFGWEFLTSVVG
LSKDRMWITIFREDDEADRLWQKIGVSPSRIVRCGEKDNFWQMADTGPCGPCSELHFDQG
PSVPGDATPNGEGDRVIEIWNLVFMQFNRDSAGTLNPLPKPSIDTGMGLERLTAVAQGRL
SNYDSDLFAPLLAAIGTRAGAQYGAVEQADRSMRVIADHLRAITFLMADGVLPSNEGRGY
VLRRILRRAARHGRLLGITEPFLHELTATVVEQMGEAYHELRPAAGTVAEATRGEEERFI
ATLDQGLPILNDMLTKVRASGQNMLSGTEIFKLYDTYGFPMDLIAEACREQDIRLDETGF
EAAIEEQRTRARKTGGFESETARPALSEVAARVGTTAFVGYDHLNSEGVVQALLKGDRLV
KEAREGDEIEVVLDVTPFYAEGGGQAGDQGLLTGPDGRVEIRETTRPVPTLIVHKGVVTS
GSIREGERLQLSVNRRTRQDAARNHTATHLVHAALRDLLGPHVKQYGSLVAPNRLRFDFA
HFRSLASRDIDEIESIVNEQVRQDQPVQTDVMGVQEAVAGGALAFFGDKYGDQVRVVHID
TFSKELCGGTHCRRTGEIGLFRIVSESGVAAGVRRIECLTGSGALDSLKRLEADVRELSD
LLKVAPGEVVSRTRKLSEQLKEKERELAEVKLKMASTSSGDSQAREIKGVQVHAQRTDGL
DVNGMRALADQLRDKLRSGVVALGAANDGKVSLLVVVTKDLVGRLKAGDLIKEMATEVGG
TGGGRPEMAQAGGKNPEGLGTALEKVFGLVQKALEG
Download sequence
Identical sequences D8PDY1
WP_013248264.1.3676 gi|302037043|ref|YP_003797365.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]