SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302037077|ref|YP_003797399.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302037077|ref|YP_003797399.1|
Domain Number 1 Region: 2213-2770
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.44e-163
Family Acetyl-CoA synthetase-like 0.0000000555
Further Details:      
 
Domain Number 2 Region: 1135-1712
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.44e-159
Family Acetyl-CoA synthetase-like 0.0000000114
Further Details:      
 
Domain Number 3 Region: 10-574
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 3.79e-106
Family Acetyl-CoA synthetase-like 0.00043
Further Details:      
 
Domain Number 4 Region: 1979-2240
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.11e-57
Family NRPS condensation domain (amide synthase) 0.055
Further Details:      
 
Domain Number 5 Region: 890-1140
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 5.78e-51
Family NRPS condensation domain (amide synthase) 0.03
Further Details:      
 
Domain Number 6 Region: 1793-1971
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.45e-48
Family NRPS condensation domain (amide synthase) 0.019
Further Details:      
 
Domain Number 7 Region: 2826-3096
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.37e-43
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.0018
Further Details:      
 
Domain Number 8 Region: 704-879
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.45e-35
Family NRPS condensation domain (amide synthase) 0.029
Further Details:      
 
Domain Number 9 Region: 1692-1764
Classification Level Classification E-value
Superfamily ACP-like 8.77e-21
Family Peptidyl carrier domain 0.0018
Further Details:      
 
Domain Number 10 Region: 2750-2823
Classification Level Classification E-value
Superfamily ACP-like 1.44e-19
Family Peptidyl carrier domain 0.001
Further Details:      
 
Domain Number 11 Region: 603-697
Classification Level Classification E-value
Superfamily ACP-like 0.0000000000000288
Family Acyl-carrier protein (ACP) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302037077|ref|YP_003797399.1|
Sequence length 3120
Comment putative multi-domain non-ribosomal peptide synthetase [Candidatus Nitrospira defluvii]
Sequence
MVRHPSVTIPPGETLLDVLRWRAEHQPDQSAYIFLRDGISPDTVLTYRQLDAKARSIAGR
LQSIFAAGDRLLLVYPPGLEFVQAFWGALYAGLVAVPVPPPDAFRSKVGIARVQRIAEDA
GVAGALSTNQIVELVRAQEPAISLEQWLVCDAATPDSTVQWTPTHPVDSTLAYLQYTSGS
TSVPKGVMVSHGNMTAQSRCITEAGCYDAESVTLSWMPHFHDYGLVKGIIQPAWIGRPAY
LMSPLTFLKRPLRWLEAIQRYQVTHSGAPNFAYRRCVETIAPEDRATLDLSGWRVASCGA
EPIAHDTIDRFAEAFAPSGFRREAFFPAYGMAEYTLLISLKREGVAPTLLPLDPLALEQG
VVAEATAGMAPVRQVVGCGIPVGDTRVVIAHPETLSRCAAQQVGEIWLAGASATQGYWNN
PEETARTFRAMLRDTGEGPFLRTGDLGFVRDGEVFVTGRLKDLLIVRGRNHYPQDIERTV
EQSHSLFRGGGAAAFSVQDAGEEAVVVVQEVERRATALAIDEPAAAIRSAVSEQHDLHVF
TIIFIKAGSLPRTSSGKVQRRACRDQFLAGQLSILGKSVLPATPSQTRSAVVKIEDLCAL
SPDTRRRQIEQVVRGMIAERLGCSREAIAADRPIHLLGLDSLMAAEVSHCVEESFHVPLS
LHQLLGGATLGDLAATIEAGMLREGSELAAADGQNLTAENVAPLSENQAALWFLSQLAPD
SAAANVSVILPLPFDVKQAALKQSLDRLGERHATLRTTYETQDEVPVQRIHARLPLSWTV
IDASTWDWSRLRREAMEAAAIPFNLAHGPLWRASLFTGKQQAWLLLVAHHIAVDGWSMIH
LVEDLKRDYASDGFMLQDGSNGLGSQPAPYGEFISWHRALLESVEGGRLAQYWKAQLAGE
LPNYDMLYDRQPTTVEPSRYAWQTIHIDRALTEQLKAFAQAEGTTLYAVCLAALHALLYR
YTNVEDTAVITPVFGRSRSRFARTVGDFVNMLVLRETVQVDASGRELLAQTKRTLLEALD
HQDYPYARLVSDLRPARDRQRAPLGQILFVLQQFKLLAELDRRMGASPSSVAESCLPQWE
AYVIPQQSGQFDLSLELAESEQGVTGYFEYKDELFAPDRVARMQQHFVRVLEGLVADPAA
PIGSLPLMSEAECRETVLMWGQSPEPQEPAECLHRLIEAQVSHTPDAIAVRQGDRELTYR
ELNARANRVAHYLRRRGVAPGMVVGLCLERSLNLIVGMLGILKSGGAYLPLDADYPTDRL
EYMLRDSQVRVLVTQQDQLARLPATNPHTICLDSEWDQIARFPDDAIEGADAPENLAYVI
YTSGSTGQPKGVMIEHRSIANYVRAITEIAGVHSRDRVLQFASMSFDTAAEEMFPCLTTG
ATLVLRTQMMIDSVSGFLDRCRDWQLTLLDLPTAYWHEVVTRMELEQLAFPDSVKTVIIG
GERVLPQIVQRWARLVGRTVRLLNTYGPTETTVAVTWSDLTGLGLQEELREDVPIGRVIS
QSSVYVLDRHRRPVPVGVPGELYVGGVGVARGYRGRPELTDTKFIPDPFSSLPGARLYRT
GDLVRWRPDGQLDYRGRVDRQVKIRGYRIELEEIEAVLNRHPDLERAVVEVREDQPGDKR
IVAFMVPRPQNRLGLVQLREQLRSQLPAHMIPSAFVEMETLPLTVNGKVDRVALRVATDS
RASKVDLTSEFLAPRTPTEQVLADIWGDILHVKDVGVHDNFFELGGHSLLATQLVSRVQA
LFRVVLPLRQVFERPTIATLAEVITRSQEAGKQQSERDRQAMTKAARGTPLPLSFAQERM
WFLYQLSPSGSAYNIPASVRLHGPLNRAALRWGLAELVRRHDALRTTFATVDGQARQIIH
ASLDPLWVEEDLRGLPREMREARGLELATAEARRPFDLGQGPLLRILLVQLGEEDHVLVV
STHHIISDQWSYGVIARELVKCYNAFCAGKPVAIQPDLAIQYADFAQWQRTWLTGSVLAE
QLAHWKSKLTDLPVLALPSDRPRLPVHSFKGDQVSLDLSWALVNRLKQLSVREGVTLYMV
FLAGFFGLLHRLTQQRDLVIGTPIANRHRLEIEELVGTFVNTLVLRTDVTGELTFRELLR
KVRDLSLDAYAHQDIPFEKLVEELRPDRSQGGLPLVQVLFNFANTPFARTEFQHLSWTPY
EVSRGAAQLDLGLSIDPLASRKAYLEFNTDLFDRTSAERWLAEYRQFMEVIAEHPEEKVG
RVTILAEQEQHRILREWNATEKPVDCETCFPQLFEAQVGRTPDAIAVVFQGAELSYAELN
RRANRLAHHLREQGVGPDVVVPVFLERSPELLISLLAVMKAGGAYLPLVPGLPIRRLAAM
IEASHAAVVVTDSKLLGGLPQHQLRVVCLDGEAELLTRYSEKDPAPLAKPEHLVYVLFTS
GSTGQPKGVEIEHRALVNFLRSMQREPGLSNRDVLVALTPLSFDIAGLELYLPLLVGARI
VLANREQAMDGAWLQRELDQGTSTVMQATPATWRMVLQFGWKGGRGVKVLCGGEALPREL
AQELLTRAGSVWNVYGPTETTIWSTLERVRTAERTISLGRPIANTQVYVLDLNREPVPVG
IPGELYIGGMGLARGYRGAPQLTAERFVSNPFRAGERLYRTGDQVKWLPDGRLDYIGRID
YQVKLRGFRIELGEIEAVLAGDPAVKQAVVIVREDAPGDKRLVAYVVAREGRSCDPQALR
RALRDMVPDYMVPAAIVPLNEFPLTPNGKVDRGALPAPVAEPVHDSAQPIEPRNRVELQL
VAIWEQVLGITPIGVRDNFFALGGYSLLALRMFSAIEQTFGIRLPMAVLFQTPTIEQLAD
VLADEGCTVRWRSLVAIQPEGKNSPFFAVPGVGGNVLVFARLAKLLGDTQPFYGLQARGL
DGKEKPFMRVEEMAAHYIEEIRSVQPQGPYLIGGTCTGGLAAYEIAQQLMAQGEQVILAV
MESWHPRSYLTHWTRPPYLLWPILFVWMKITTYLRLMRRLPIQEWPSFWRGKLKRIWNLM
HHTEAAEHQDEFLYKDQVTYATFHAVARYDLKPFRGPVLNVIASKHPLTNSSDDTRLVFG
ESARGMSRTIYLPAEDSGRLFVAPHVQELAHHLKSFWQEAWATLQNKSDDQGKGPSSKAA
Download sequence
Identical sequences D8PE15
gi|302037077|ref|YP_003797399.1| WP_013248298.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]