SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302037198|ref|YP_003797520.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302037198|ref|YP_003797520.1|
Domain Number 1 Region: 903-1226
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 1.44e-131
Family Methionine synthase SAM-binding domain 0.000000017
Further Details:      
 
Domain Number 2 Region: 5-400
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 1.83e-108
Family Homocysteine S-methyltransferase 0.0000044
Further Details:      
 
Domain Number 3 Region: 357-631
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 8.24e-89
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.0025
Further Details:      
 
Domain Number 4 Region: 745-895
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 6.02e-44
Family Cobalamin (vitamin B12)-binding domain 0.00000107
Further Details:      
 
Domain Number 5 Region: 650-737
Classification Level Classification E-value
Superfamily Methionine synthase domain 2.35e-29
Family Methionine synthase domain 0.0000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302037198|ref|YP_003797520.1|
Sequence length 1227
Comment methionine synthase [Candidatus Nitrospira defluvii]
Sequence
MPVHEVRDLLRERILILDGAMGTMIQRYKLDEAAFRGERFRNWSKDLKGHNDLLNVTRPD
VIEAIHRQYLEAGADIIETNTFNSQSVSLADYGMDDLGYELSKAGAECAKRAVAQVVAAH
PARRCFVAGAIGPTTKTSSVSTDSNDAAARGTTYPELVRAYGEQVRGLLDGGVDLLLVET
IFDTLNAKAAFFAIQQLFAEGARQVPIMASVTFIQAGSNRGFSGQTVEGFWNSISHVPLL
SVGMNCALGPKEMRPLIEELSQIAPIFVSSHPNAGLPNPLLPTGFPETPDSLAPQLREWA
QNGWLNIVGGCCGTTPDHIRSIATAVNGVTPRQPSKVEPYLRLSGLEALTVRPESNFVNV
GERTNITGSPAFSKLILTGDYDKALTVARQQVEGGAQVIDINMDEGMLDSKAAMQKFLRL
LAAESDIARVPIMVDSSKWEVIEEGLRNMQGKGIVNSISLKEGEAKFLEQARLIRRYGAA
IVVMAFDERGQADSVARRIEICERSYRLLTEQVGVPPQDIIFDPNILTVATGLEEHNNYA
VDFIEATRWIKQHLPLAKVSGGVSNISFSFRGNNVVREAMHAAFLYHAIQAGLDMGIVNA
GQLAVYEEIPKDLLLLVEDVLLNRRPDATERLVTFADTVKQKGKAAVKDDEWRTRPVEER
LAHALVKGLTDYIDQDVEEARQKSVRPLDVIEGPLMAGMNIVGDLFGSGKMFLPQVVKSA
RVMKKAVAYLMPFMEAEKLRLGTSRANGKVLLATVKGDVHDIGKNIVGVVLGCNNYEVID
LGVMVSCETILATAREQQVDMVGLSGLITPSLDEMVHVAKEMTRQGFTVPLLIGGATTSK
AHTAVKIAPSYGHATVHVLDASRAVGVVGSLINDEQRESFSAGVRADYDRIRQAHQDRGQ
KVLRSLDEARQHKLPTDWAAADIPVPSFTGVRQIDRMPLRELVPYIDWSPFFHTWELRGR
YPSILDDATVGPKAKELLADAQALLEEIIRGELLTARGVYGFFPANSAGDDIHLYRDQDR
REPLATFHTLRQQMEKPADQFNLALADYVASKESGRADYVGAFVVTAGIGVPALCAKYEK
DHDDYNSIMVKALADRLAEAFAEWLHQQVRLEWGYGKTENLTNEDMIRERYRGIRPAPGY
PACPDHTEKRTLFDLLNAEAQAGVTLTESYAMLPAAAVSGLYFAHPEAKYFAVGKINRDQ
VEDYATRKKLPVSEVERWLAPNLNYDA
Download sequence
Identical sequences D8PED6
WP_013248419.1.3676 gi|302037198|ref|YP_003797520.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]