SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302037359|ref|YP_003797681.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302037359|ref|YP_003797681.1|
Domain Number 1 Region: 6-321
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 5.28e-114
Family Adenylation domain of NAD+-dependent DNA ligase 0.000000111
Further Details:      
 
Domain Number 2 Region: 409-587
Classification Level Classification E-value
Superfamily RuvA domain 2-like 1.89e-57
Family NAD+-dependent DNA ligase, domain 3 0.0000511
Further Details:      
 
Domain Number 3 Region: 324-397
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.31e-24
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.0019
Further Details:      
 
Domain Number 4 Region: 597-672
Classification Level Classification E-value
Superfamily BRCT domain 1.6e-18
Family DNA ligase 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302037359|ref|YP_003797681.1|
Sequence length 675
Comment DNA ligase (NAD(+)) [Candidatus Nitrospira defluvii]
Sequence
MSNQPMPHQTAEQRIADLRRQIRHHDHLYYTKDRPEISDAEYDRLFRELVDLETAHPDLV
TGDSPTQRVGAPPLDELTKVSHEKPMLSLDSITDQDDVRAFDARMKRELETDQIVYTAEP
KFDGLSVELVYDRGAFVRGATRGDGMVGEDVTINLRTIRALPLQLDPQPSLPAHLVVRGE
VYMRLDEFQVLNRRMTERGEEAFANPRNAAAGSLRQLDSRITASRPLTLTCYDIMAISGT
APPTHWDELDALAAWGLPVPEHRQRCRSIDEVLSFQQATDAMRDSLPFEIDGVVVKLDRR
TWQDQLGSKSRSPRWAIAYKFAPRKEITVIQDIAVSVGRTGTLTPLALLKPVEVGGVTIS
RATLHNADEVARKDVRVGDTVKVERAGDVIPAIAERVPVPGETRQEPFVMPDHCPVCGSA
VAREGAYFYCTGQTVCVAQLKGAIEHFASKSALDIDGMGKKTIAQLVDVGLVRDLADLYS
LTKDQILTLEGFADRSANLLLESIERSKSVSLDRLLMGLGIRQVGQHIARVLAKQFGTLS
KLMSATQEDLLQVREIGPEISASLTSFFSEERNRAVIARLIERGLTIAPPTTENTTGSQH
LAGKTFVFTGGLEGYSRDQAKELVEQQGGQVSSSVSKKASFVVAGTDPGSKLDQAQKLGV
RILTEAEFTALVRPE
Download sequence
Identical sequences D8PEU7
gi|302037359|ref|YP_003797681.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]