SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302037376|ref|YP_003797698.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302037376|ref|YP_003797698.1|
Domain Number 1 Region: 151-490
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.59e-119
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000248
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.43e-37
Family Anticodon-binding domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302037376|ref|YP_003797698.1|
Sequence length 493
Comment lysyl-tRNA synthetase [Candidatus Nitrospira defluvii]
Sequence
MDELNDQRQQRIKKLDHLRQLGVAPYGTRFEVKDRAGQLTRLHGEKTKEVLEQEQISCTI
AGRIVGLRRFGKAAFAVLQDGSDRLQVYLKKDTLGEQAHQISEGLDLGDWIGVTGVLFRT
KTNEFTVEVKVLTFLSKALRPLPEKWHGLTDVETRYRQRYVDLIANPQVHQIFALRSRIV
SGIRAFLIERGFLEVETPMMHPIPGGAAAKPFVTHHNALGAELYLRIAPELYLKRLIVGG
FPRVFEINRNFRNEGISTIHNPEFTMLEFYVSYADYHDLIVLTEELFGRLAQDILGTTTI
DYQGTHINLGSPWRRWSYHQSILEVNSLPPSVLTNRDEALAAAQRLGVEVSPKESLVNIL
NEIFEETVEPRLQQPTFITDYPIEISPLARRKDSDPSLTDRFELYIAGREIANAFSELND
PLDQRERFEAQAAKHAAGDEEAHRVDEDFLRALEYGMPPTAGEGIGIDRLVMLFTNQSSI
RDVVLFPQLRPEK
Download sequence
Identical sequences D8PEW4
WP_013248595.1.3676 gi|302037376|ref|YP_003797698.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]