SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302037473|ref|YP_003797795.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302037473|ref|YP_003797795.1|
Domain Number 1 Region: 1111-1592
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 4.58e-130
Family Acetyl-CoA synthetase-like 0.000000111
Further Details:      
 
Domain Number 2 Region: 8-567
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 5.89e-117
Family Acetyl-CoA synthetase-like 0.00031
Further Details:      
 
Domain Number 3 Region: 879-1122
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.78e-62
Family NRPS condensation domain (amide synthase) 0.023
Further Details:      
 
Domain Number 4 Region: 691-868
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 3.45e-48
Family NRPS condensation domain (amide synthase) 0.0012
Further Details:      
 
Domain Number 5 Region: 1716-1874
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.36e-24
Family Guanidinoacetate methyltransferase 0.00044
Further Details:      
 
Domain Number 6 Region: 599-701
Classification Level Classification E-value
Superfamily ACP-like 1.83e-18
Family Peptidyl carrier domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302037473|ref|YP_003797795.1|
Sequence length 1907
Comment putative multi-domain non-ribosomal peptide synthetase [Candidatus Nitrospira defluvii]
Sequence
MLRNACQYQTLVELLRVRVSEAPTKHAYTYLRDGETDALTWNYGELDRRARAIAAWLQSC
GAAGERALLLYPPGLDYLAAFFGCLYAGVVAVPAYPPQRQRGWPRVRAMLADSQAAYALT
TSGIARAIDRLSAKEDGYGRLATLQWLNTDHVPSGIDEDWSEPDITPETLAFLQYTSGST
ALPKGVMVSHANLVHNQRLIQAAFGHTSQDVIVGWLPLYHDMGLIGNVLQPLHLGASCIL
MSPVHFLQKPVRWLSAITRYRATTSGGPNFSYDLCVRQITAAQRELLDLSSWTLAFNGAE
PVRAETIERFSDRFRDRGFRKEAFYPCYGLAEATLLVSGGTRGTGPLVQPFEYSRLSSEP
TASASGAASHLLVSCGVDRSGRQIRIVHPDSGIACAEGQVGEIWVSGPCVAQGYWQREQE
SRETFQTSLGGTGEGPFLRTGDLGFLKDGELFVTGRLKDLIIIRGRNHYPHDIERTIEEC
HPGLRPGAGAAFAITEGDEEQLVVVQEVEPRSQALDLQAITTAIRQTVAQAHEVSVCAVV
LIKAGTLPKTSSGKVQRSLCREKFLARELIAVEESVLRNSTAAVVLEEDPALAGDEGGLE
QELVDIWSQVLSRPNIKSGDDFFALGGDSLRGLQVVARVREVRGLNVPLDALFDYPTLAA
FSAHVATCVPAEPGSPIKSIRRVSRDETLPLSFAQERFWFLDQLSPGSSINNIPVALRLV
GSLDVEALRRSLDEIVQRHEILRARFALRNGRPSHIMVPKLTLALEVEDLRRSVEAGGDE
LVLRLVREEACRPFDLAKGPLVRGRLFRLDTMNHVLSLTLHHIVADGWSMDVLRRELASL
YESFKNHRPSPLPALPIQYVDLIAAQLEQAKGENDRRLLEYWVDQLEGAPPLLNLPWDYP
RPAIQGHRGARHPWTVEPELAHRLYEAGARYRATPFMLLVSALGLLLSRYSRQTDFCIGT
PVANRVGREAGQLVGCFVNTVALRMDVSGNPSWPALLDRVREMVLGAQSHQDLSFERLVD
ELGVVRDLGHTPLFQVMFVLEDSPSDVRRFADLEASRLNVGTGTSVFDLTLEMAQKTDGS
LDAVFEYSTDLFAADTIARMAGHLQALLQQIVASPEASVSELSILSPGEQALELADSRSP
REAYLQEASLHHLIEAQASKTPDAVALQCDRGPVTYDSLNRLGNQLARYLRVQGIVHEVP
VALCVDRSLEMAVGILGCLKAGATYVPVDPSYPTERQAAIFRDAQPQLVLTQGRYLESLP
EHTAPVLALDVEWPAVAGLPDDNLVTGSNPDRLAYLLYTSGTTGIPKGIGITHRALVNHG
LAMVRAYDLSPADRVLQFASVSFDVAAEECFPTWLAGATVVLRANEPVPAYGDFQAFVHA
QGVTVVNLPTPYWAAWAEESERIGAAIPSSLRLVIVGSEKALPDDLRRWRRTAGERVDWC
NSYGPTEATITASTYRPGPAQDDTTLRTIPIGRPIANVEMYVLDRHLHPVPAGVPGDLYI
GGPGLARGYHRRPALTAAQFIPHPFSHDRGARLYRTGDVARRRSDGHLEFLGRADEQVKI
RGFRVEPQEIECHVRAHPAVKDARVFLESEAPGDWSAVLAGLSDEEQDRLVRDVEALSAA
EARWLYDLESDGEQRRKTVIQRKPEFEVYLKINKEEFLTPPRANQRNWLLRRALDEFSDD
LLALDEASKRFVSGSDRADIERGWAESRAEYNPSELIIEGQQVMQDWEAPLMKAMADIVT
DGHGDVLEVGFGMGISASYIQAGRPSSHTIIECNRDVMRAFAEWTDKYPDRDIRLVQGRW
QDVVEDIGLFDGVFFDTYPASEAEFEESVINSINFAEGFIPVAAKLLRPGGVFTYYTNEI
DSFSRRHQRFLLDHFGSFTLSIVRSLLPPDDCHYWWADSMAVVKAVK
Download sequence
Identical sequences D8PF61
gi|302037473|ref|YP_003797795.1| WP_013248691.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]