SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302037474|ref|YP_003797796.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302037474|ref|YP_003797796.1|
Domain Number 1 Region: 29-122
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.27e-20
Family Acetyl-CoA synthetase-like 0.0024
Further Details:      
 
Domain Number 2 Region: 104-175
Classification Level Classification E-value
Superfamily ACP-like 1.27e-19
Family Peptidyl carrier domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302037474|ref|YP_003797796.1|
Sequence length 214
Comment putative non-ribosomal peptide synthetase (fragment) [Candidatus Nitrospira defluvii]
Sequence
MEDRFQQIERLSDAQRRLLGLRAGRQARATEARLVGYIVPRTTGGVTGQDLRGFLAQRLP
DYMVPSGWVFLEAFPMTSRGKIDRKALRAMGRSKPEALSAQGTPRDDRERAVAAIWEEVL
GVRGVGAHDNFFDLGGHSLLLPKVLTKVRAMTDREVSMVDLFRYPTVHALAAALAGSHDT
QADGVGSRQLKETRDAGVRRMKQRRTKQIASRNE
Download sequence
Identical sequences D8PF62
gi|302037474|ref|YP_003797796.1| WP_013248692.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]