SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302037475|ref|YP_003797797.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302037475|ref|YP_003797797.1|
Domain Number 1 Region: 16-133,162-388,420-441
Classification Level Classification E-value
Superfamily Thiolase-like 1.6e-82
Family Thiolase-related 0.0026
Further Details:      
 
Domain Number 2 Region: 540-670,730-833
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.46e-72
Family FabD-like 0.00031
Further Details:      
 
Domain Number 3 Region: 1146-1336
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.33e-36
Family Tyrosine-dependent oxidoreductases 0.00048
Further Details:      
 
Domain Number 4 Region: 905-1134
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.9e-17
Family Tyrosine-dependent oxidoreductases 0.056
Further Details:      
 
Domain Number 5 Region: 1420-1488
Classification Level Classification E-value
Superfamily ACP-like 6.67e-16
Family Peptidyl carrier domain 0.0038
Further Details:      
 
Domain Number 6 Region: 668-728
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.000000000301
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302037475|ref|YP_003797797.1|
Sequence length 1517
Comment putative polyketide synthase [Candidatus Nitrospira defluvii]
Sequence
MSHSPLEFDQTEPRDGLDIAIVGMAARFPGAPDLGTFWRNLCAGLESVSRLTPQELAEAG
VDRKTAGRPNYVGARAVLEGIDLFDAPFFSMTPKEAETTDPQQRLLLECAWETLEDAGYD
PSRYKGSIGVYAGSSTSGYLYHLFPSRVLLQSPAEMSAMLGVEKDTLATRLSYKLNLRGP
SLAVQTACSTSLVAVHLACQALLSGECDMALAGGVSVTVPQKVGYLYQAGGIVSPDGHCR
TFDAQAEGTVGGSGVGLVLLKRLHDALDEGDHILAVIKGSAVNNDGAAKVGYTAPSIEGQ
AQVIEAAHVAAGVRADTISYIEAHGTGTPMGDPIEVAALTQAFRVSTSRTGFCAIASVKT
NIGHLDAAAGIAGLIKAVLALVHRRIPPSLHYAAPNPAIDFSTTPFYVQTALTEWAGGSS
PRRAGVSSFGLGGTNAHVVLEEVPAVTPRLSPDDEQWRLLILSARSKAALDRASERLGEH
LATQAVINLDDVAFTLQCGRKAFAHRRWAVVKTIEAARQALAHPFLMSGTAGPTGEARQV
AFMFSGQGSQYPHMGLSLYDQEPTFRRHVDQCASLLSRHLGRDIRQVLFPPSPGDAELIH
RTALTQPALFVLEYALAQTWMSWGLRPAAMIGHSIGEYVAACLSGVFSLDDSLAIVAMRG
RLMQALPAGGMAAVPLTEAEVVPLLSAGLDLAAVNAPAQCVVSGPHDRLEAFEERLAARG
TKMRRLATSHAFHSSMMEPMLARFESFLASLPSQEPQIPWVSNLTGTWIRREDATDPAYW
SRHVRATVRFADGLRTLLDDQPPVLLEVGPGRTLQTLAQRHSGSTAVSSFASFSGREQDE
MAGLLMTLGSLWGAGVPVEWNGLQRARPPRRVPLPSYPFERQRYWLDPREDRPDSVADGG
HRADLSQWFYEPSWKRSALVPTSSGRSHDHWLVFVGDRETESVLRSQLESRVASVTAVFP
GAGFECHADGSYRVRPDSREDHASLLEELTARGQVPHCLLHAWGLESTGTDTSADTRMRT
AQERGFLHLVILAQTFGGRRDNRCSILVLARGLHDVTGDELLRPEWTTMLGACLVIPQEY
AVLSCRLLDLDRRAFQPPFVNVWGERLVTEAGLSRGAPVVAYRGQHRWVRTFEPLCLDAK
GGDRLPFRQGGVCLITGGLGGVGLHVAEHLIRTVRARLVLVGRSHPTAEQREFVAALERL
GNEVLVCRADVADRAQMQRVIDEAHQRFGGIHAVVHSAGVAGGGLLALKTPNAVWEEFRA
KVQGAAVIDALFRDEPLELLLFCSSLTAVAGGVGQSAYCAANAFLDALAHAGRREARRVI
SVNFDRWRHIGMARQAEATLRALDAADSDVDGMDAVEGLEVLRRILAGPDLAQVVQSIRD
LPAVMASVSHLGLLDRGGLSQKAKSTDELIPVSFGEVEKEGLEAQLAALWRQVLGLEHVG
LEGDFFQLGGESLSALQILNRIQELHHVELSLREFLSAPTIHGLAGQIRTAQAAGRRKEQ
GIVPIPREGRRLRGVSA
Download sequence
Identical sequences D8PF63
WP_013248693.1.3676 gi|302037475|ref|YP_003797797.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]