SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302037482|ref|YP_003797804.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302037482|ref|YP_003797804.1|
Domain Number 1 Region: 1527-2089
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 3.01e-165
Family Acetyl-CoA synthetase-like 0.0000000304
Further Details:      
 
Domain Number 2 Region: 447-1018
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 6.15e-147
Family Acetyl-CoA synthetase-like 0.000000101
Further Details:      
 
Domain Number 3 Region: 213-458
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 5.11e-63
Family CAT-like 0.084
Further Details:      
 
Domain Number 4 Region: 1289-1553
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.33e-57
Family NRPS condensation domain (amide synthase) 0.032
Further Details:      
 
Domain Number 5 Region: 33-205
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.02e-47
Family NRPS condensation domain (amide synthase) 0.016
Further Details:      
 
Domain Number 6 Region: 1104-1304
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.67e-46
Family NRPS condensation domain (amide synthase) 0.0062
Further Details:      
 
Domain Number 7 Region: 998-1071
Classification Level Classification E-value
Superfamily ACP-like 1.19e-19
Family Peptidyl carrier domain 0.0045
Further Details:      
 
Domain Number 8 Region: 2068-2138
Classification Level Classification E-value
Superfamily ACP-like 2.88e-19
Family Peptidyl carrier domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302037482|ref|YP_003797804.1|
Sequence length 2178
Comment putative multi-domain non-ribosomal peptide synthetase [Candidatus Nitrospira defluvii]
Sequence
MQSRSSMLMPHDQTQDPLADVHGSEPEQYLFPMSFGQRRLWFLSQLEPESASYNTAIAVR
MKGRVDRRLLVDCFNRIVERHEVLRTSFSTEHGEPVQIIATVGRVTLETDLVANQPEAIL
VAARDEAQRPFNLQQAPLLRLRLFDIADDDHLLVVTLHHIVCDGWSAQILAREFAQLYVE
AVEETDAPLPALPIQYADYAEWQRGWLQGAVLDRHLAYWTRHLAGDLPVIELPTDRPRGA
VQTSSGSRYVFTLPQFVADGLRELSRRHNVTLFMTLLAACQTWLMRYTGIGDVCVGTPIA
CRTKRETEDLIGFFANTLVLRTDLSQNPTFPQLLERVREVVLGGQEHQELPFEELVDALK
PARALSHSPLFQVLFALQTTLAEAVRLPGLHVEITEVDAAAAKFDLSLDMAETEAGLEGA
LEYNTDLFDAATVARMAGHFQTLLAGIVETPDCRLHELPLLSVEERQEALLVGPDDRVTD
ECFDFAAAFSAQVERSPDAVAVECRGEIRTYAELNREAERIARALTVSGIGPDKIVALLL
DRGIGLLTAIVGVLKAGGAYLPLDPSHPPARWGELIHSSAASVVMASESYRARVAESSPR
FASGDTILLAIEDCEGNTENASPPPCICSPDQLAYVIYTSGSTGIPKGAMVTQRGLMNHL
WSKRDSLGLGADDVVAQTASACFDISVWQHLAALICGGRTLIVPDDEARDPVRLVICLER
DAVTVAETVPALLKGIVDGPQAADVPLRSLRWLLPTGEALPPPLCREWLRRYPHVPLVNA
YGPAECADDVATATIASPPAADELCMPIGRPIRRTRLIVVDRWLAPVPVGVPGELCIGGI
GVGRGYLQDPARTAAAFVPDPFGTEPGARLYRTGDLVRRRKDGSLEFLGRVDHQIKLRGV
RIEPGEIDARLRELAGVRDAVTVVREDRPGQKRLVAYVVTSDQAASSIETWRAPLRSQLP
EVMIPSRFVRLDALPRTPNGKVDRASLPVPDDPGDEGYAAPRNSVEAQVALIWAEVLQRD
RVGIHDNFFELGGDSILSLEVVSRARQAGFNLTPRQVFQHQTVAELTALLAQSIEVPPAI
TDEELSAELVDAATGAAAKAACANYEDVYPLSPLQQGLLFHSLYAPASGVYIEQMSWRMA
GELDVPAFREAWQQTVARHPLLRTRFLWREVSSPIQIVLPAAEIAWREVDGQDGSPSDRA
ARFSRLVEEDRLTDFDFERPPLMRILLFRVGRDSYDVLWTHHHILMDGWCLPILLQEVLT
AYQALRRGAAPLFEPVVPYRHHIVRLLGQDQAEAERFWRTALKGVTTPTVLGEEVAPEEA
GQQRSSGTAAITLSPEASAQLLLFAQRHHVTLNTLVQGAWALLLSRYSRESEVLFGTTVS
GRSADMPGIERMVGLFINTLPLRVRVAPDAVLSEWLRALLEHNSELRQFEQTPLVQIQGW
SGVPRGQALFESLIVFDNHPLDESLEQTTGLTIHAVTLQGQTNYPLTLNVLPGQELTLSL
WYHRNRFRDETATRMVRQLETLLTAMIQNPHARLGLLPLLAAAERSQVVEAWNRTGRAYP
AGAVPAQIAAQAARTPEAVAVRAGRTTVTYAALLAQASRLAQALQARGIGPEGLVAVALE
RSVDLVVALLGTWYAGAAFVPLDPTYPTERLRYMLQDSQAALLLTDAVQAARLAHDGPTL
CLDRDRTTLDGYPLTPPVQATTGTQLAYVLYTSGSTGQPKGAGNSHAGLRNRLQWMQEAY
GLTPADRVLQKTPISFDVSVWEFFWPLLVGAELVMAEPGAHKDPARLIQHIVEQGITTLH
FVPPMLQAFIDQPGVETCRSLRQMLCSGEALPATLPPRVQQRLPEVALHNLYGPTEAAID
VTAWTCPTPPAATVPIGRPIANLQIYVLDPQGEPVPIGVPGECYIGGIGVGRGYHRRPDL
TAARFVPDPFSEQPGQRLYRTGDLVRYRPDGAIEYLGRLDHQVKIRGVRIELGEVEAALR
QQPGIREAVVLARRDGPGGARLVGYVTTVPEPPFDAAGLRQALAQTLPEYLVPAVIVRLA
QLPLSPNGKVDRRALPAPEVEAQRTQAYAEPTTATEQQLAAIWAQVLGLARVGRHDNFFE
LGGDSITSLQVLAKAHREGITLTPKQLFEHPTIASAAAVAVIGTAEAMPPLPDEKRADGI
VDVELSDEEMENLLKEIG
Download sequence
Identical sequences D8PF70
gi|302037482|ref|YP_003797804.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]