SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302037483|ref|YP_003797805.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302037483|ref|YP_003797805.1|
Domain Number 1 Region: 1523-2083
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.26e-165
Family Acetyl-CoA synthetase-like 0.0000000297
Further Details:      
 
Domain Number 2 Region: 448-1023
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 4.06e-156
Family Acetyl-CoA synthetase-like 0.000000062
Further Details:      
 
Domain Number 3 Region: 1286-1548
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 4.56e-66
Family NRPS condensation domain (amide synthase) 0.041
Further Details:      
 
Domain Number 4 Region: 206-456
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.78e-58
Family CAT-like 0.028
Further Details:      
 
Domain Number 5 Region: 1101-1278
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.56e-47
Family NRPS condensation domain (amide synthase) 0.026
Further Details:      
 
Domain Number 6 Region: 28-205
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 9.34e-46
Family NRPS condensation domain (amide synthase) 0.0063
Further Details:      
 
Domain Number 7 Region: 2342-2589
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.33e-44
Family NRPS condensation domain (amide synthase) 0.034
Further Details:      
 
Domain Number 8 Region: 2158-2332
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.05e-34
Family NRPS condensation domain (amide synthase) 0.017
Further Details:      
 
Domain Number 9 Region: 1002-1111
Classification Level Classification E-value
Superfamily ACP-like 3.53e-24
Family Peptidyl carrier domain 0.0015
Further Details:      
 
Domain Number 10 Region: 2062-2134
Classification Level Classification E-value
Superfamily ACP-like 2.22e-17
Family Peptidyl carrier domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302037483|ref|YP_003797805.1|
Sequence length 2623
Comment putative multi-domain non-ribosomal peptide synthetase [Candidatus Nitrospira defluvii]
Sequence
MQANRIEQGTAERAASGGLKNIEAIYPLSPMQEGMLFHTLMNPGTGIYLMQNRYYVEGEM
DAELFRKAWEQVIARHSILRTSFVWKSQKRPLQAVHKEIEVPLDVMDWKGKERAEQTADL
DALLQQELEQGFDFGKAPLMRLRLIRLTDRTYQFVHSFHHILLDEWCISPLLMDFLAHYE
ACAQGLVCRAEKPRPYRDYIAWLQKQDLDDANRFWRDYLRDFSTPTPLAYDRPPQGLADQ
NDDAADHCVHLSPDLTARLTTLAQQHRVTPNTFVQGAWAILLAYYSGERDVLFGVTVAGR
PTQLLGVESVLGLFINTLPLRVSVSPEQPVLAWLKNLLAENIRLREYEYTPLIQIQRSSK
VSRGEALFHSLFVFENAPVDPALCEGRIMFRAEEEQYRVHTNYPMTVMGWPGKELGLKLS
YDRRLFDSETVLRMIGHLKRILEGLIMRPDARIGDLPLLDHEERASLLAHGTGQTEGPRD
ERSFATRFEAQVRRNPQAVAVTCGDGSLTYEALNRRANRLAKHLRTAGIDPDSIVALLDE
RGPDLLTMIVGCFKAGAAYLPLDPHHPVARIARLLELSRVAVVVTSYGLKAYLDQVLSAM
PAASRPLVLTLDDLWSGQGCDDDRPIPSRMDQLAYVIYTSGSTGVPKGAMVTMGGMLNNM
ESKLTSLSIGPTGVIAQTASQCFDISVWQFLTGLLCGARTHIVSDELVREPARLLAHLDE
AGVTIYEAVPAVLQALLDAGDRSESQRRFSRLRWVLPTGEALPPALCRRWFERHPDIPLM
NAYGPAECADDVAVHPILAPPPEDAVRVPIGRAIQHLRLYILNRFFAPVPLGVSGELCIG
GVGVGRGYVEDRLRTAQAFVPDPFSTEPGARLYRTGDLARYRPDGTIEYVGRMDHQVKVR
GFRIELGEIESCLTDQDEVREAAVIVREDRPGERRLAAYVVPQDGRSIDSEQLRTALQTQ
LPEYMVPSIFLTLDALPRTPNGKVDRKALPAPDLDGAGGSIYVAPRSVTEELLAGIWADI
LGLERVGVRDHFFELGGHSLLATQVVSRIRSAFQIELPLRAAFECPTVADLAATVDRVRA
EGNGRQVPALTAGRREGPAPLSFAQQRLWFLAQLDPESWLYNLSFGLRLRGPLDVDALRG
SFGAVAMRHDQLRTRFLRAEGRPVQVTAESPTLPFERQFADPAPGVSLDQHVADLAADEA
RRPFAPEGSLLWRVKLVQLSEQDHLLLVTLHHVIADGWSLNLLLSDMVAAYDALRADQPV
PWTASTLHYADYAQWQRGWMTGDVLERELEYWKRTLAGAPSMLSLQPDHLRPIVQTFRGA
RHTFTIPRELTSTLQTLGRRQGTTLFMTLLAAFQVLLHRYSGEVDLSIGTPIANRTSLET
EELIGFFVNTLVLRTDLSGNPRFVDLLERVRETVLGAQAHQDVPFEQVVDALKPERDLSH
APLFQVMFALQTLGRQAMEIPGLTIEAVEVDPGSAKFDLSLEMTLAPEGLTGFFEFNLDL
FEAATIGRMADHFLTLLAGLAAEPQRKLVEFPLLAAAERSQVVEAWNRTGRAYPAGAVPA
QIAAQAARTPEAVAVRAGRTTVTYAALLAQASRLAQALQARGIGPEGLVAVALERSVDLV
VALLGTWYAGAAFVPLDPTYPTERLRYMLQDSQAALLLTDAVQAARLAHDGPTLCLDRDR
TTLDGYPPTPPVQATTGTQLAYVLYTSGSTGQPKGAGNSHAGLRNRLQWMQEAYGLTPAD
RVLQKTPISFDVSVWEFFWPLLVGAELVMAEPGAHKDPARLIQHIVEQGITTLHFVPPML
QAFIDQPGVETCRSLRQMLCSGEALPATLPPRVQQRLPEVALHNLYGPTEAAIDVTAWTC
PTPPAATVPIGRPIANLQIYVLDPQGEPVPIGVPGECYIGGIGVGRGYHRRPDLTAARFV
PDPFSEQPGQRLYRTGDLVRYRPDGAIEYLGRLDHQVKIRGVRIELGEVEAALRQQPGIR
EAVVLARRDGPGGARLVGYVTTVPEPPFDAAGLRQALAQTLPEYLVPAVIVRLAQLPLSP
NGKVDRRALPAPEVEAQRTQAYAEPTTATEQQLAAIWAQVLGLARVGRHDNFFELGGDSI
LGLQVITQAKEIGLLLTPRQLFQQQTVERLAAVVNLESPAMPTIQAEQGLVSGLVPMTQA
QRWLFEQRLSEPHHWNQSLMVTMSEAPDQARLTRALRRVIEQHDALRTRFDLSNGPTARI
EASVPCGDLLSSVDLSRVSDQELTAAVSNEAEGYQQSLNLEEGPLFRAVLFDLGPNRPGR
LLLIAHHLVVDGVSWRILLEDLERAYGVEQGGQPVFPPKTTSIKQWTDSAQALAESGVLL
GELDFWAKQDQSMDRSLPLDDPAGERTEASAETCHVGFSREETEALLRQAPAAYRTQVND
LLLAALVQTFHRWTGQEQLLLDLEGHGREPVIPGTDLSRTVGWFTSIFPLLLRLPGGSMG
EVVKGIKEQLRAVPSGGVGYGVLRYLARSPETDRLRRQSAAQVCFNYLGQLDRGSSEQAL
FGLASEPTGREHGSSNRMRYELSINADVTEGRLSVNWTYSRARIKPATIEMLAASYRQRL
CNLIVHCCAPDAGGYTPSDFPDVAIEQDALDNILEIMERNHAR
Download sequence
Identical sequences D8PF71
gi|302037483|ref|YP_003797805.1| WP_013248701.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]