SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302037484|ref|YP_003797806.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302037484|ref|YP_003797806.1|
Domain Number 1 Region: 439-1005
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 8.77e-155
Family Acetyl-CoA synthetase-like 0.0000000493
Further Details:      
 
Domain Number 2 Region: 1546-2115
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 3.4e-148
Family Acetyl-CoA synthetase-like 0.0000000513
Further Details:      
 
Domain Number 3 Region: 2676-2986
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.05e-82
Family gamma-Butyrobetaine hydroxylase 0.0000345
Further Details:      
 
Domain Number 4 Region: 2389-2634
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 5.45e-60
Family NRPS condensation domain (amide synthase) 0.024
Further Details:      
 
Domain Number 5 Region: 1306-1573
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 6.23e-57
Family CAT-like 0.03
Further Details:      
 
Domain Number 6 Region: 192-444
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.22e-52
Family NRPS condensation domain (amide synthase) 0.052
Further Details:      
 
Domain Number 7 Region: 2193-2381
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 3.11e-46
Family NRPS condensation domain (amide synthase) 0.013
Further Details:      
 
Domain Number 8 Region: 13-190
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 4.67e-45
Family NRPS condensation domain (amide synthase) 0.0048
Further Details:      
 
Domain Number 9 Region: 1126-1305
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.45e-44
Family NRPS condensation domain (amide synthase) 0.0074
Further Details:      
 
Domain Number 10 Region: 2095-2204
Classification Level Classification E-value
Superfamily ACP-like 3.66e-21
Family Peptidyl carrier domain 0.0025
Further Details:      
 
Domain Number 11 Region: 984-1054
Classification Level Classification E-value
Superfamily ACP-like 1.57e-18
Family Peptidyl carrier domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302037484|ref|YP_003797806.1|
Sequence length 2999
Comment putative multi-domain non-ribosomal peptide synthetase [Candidatus Nitrospira defluvii]
Sequence
MRDKQQIEAMYYLSPLQQGLLFHRLADAEADPYFYQYAYRLQGDLRLDAFEGGWRHVVER
HAVLRTAFVWEGVEKPLQVVRRQTALPIERHDWRGVPEEEQRLRFAALLDGDRAAGLDLL
RPPLMRLHVIRKTEREWLLVNSHHHILLDGWSMALVLRDVLTAYEALVRGAAPTVESPRP
YRDYISWVNRQDLVQAETFWHAMLAGIQRPTSIVIEAPSQDTPAETLPFAEQSLGLSIDR
MEALQSLAKRVKVTVNTLLQGAWSLLLHRYSGESDILFGATVSGRPPELAGVEEMVGLFI
NSLPIRVTIRPDQPLGDWLRDLQERNAVLRQYEWTPLSDIQRWSDVPNGTPLFESLVVFE
SYPEGSHDGEPSSLSIEPLAARSGDVYTLTPGRNNYPLSLMVEPGRDLRLIVCYAHRRFA
HAAIARMLGHLDRLLAAMAEAPEARLSDLSLLTDDERKQLIEWNGAFTSDETGARCIHDL
IAAQVEARPEATAVVTKQGQVTYQELDRRAAALARYLLAQGVRPDDRIGLCLDRSLDLVV
GIVAVLKAGGAYVPLDPTYPRERLAAMVADSQARLIVTRGDQAQGVSDFSERLILLDRQA
EEIAGCSEGPTAVPLSPSNLAYVIYTSGSTGRPKGVAVEHRQVTAYVRAILQLDPVAAGA
SMAAVSTVAADLGNTALFGALCSGRTLHLLSTEDGFDPDAMAAAMHGRQVEVLKIVPSHL
RGLLHAAQPERVLPTRCLILGGEALRRDLVQEIRRLVPGCAIVNHYGPTETTVGVLTHLV
EASQGQSESDVPIGRPLSFNQAHVLDSDGQPVPLGLPGELYIGGQQVTRGYLGRPEATAE
RFIPDPFSRVPGARMYRTGDRAKRRADGTVEFLGRVDHQVKLRGFRIELGDIEAQLRREP
GVSDAVTMVRETGDGTPQLVTYLAGPSTLDTAGIRARLAHSLPDYMVPQHFVLLDAFPLT
ANGKLDRAALPDPGQQTAAALPSYVAPRNRTEEILAAIWQTVLQVERVGVHDNFFALGGD
SIRTLQVIARANRQGVKLTPKQLFEHQTVAAAAAVAQVKPAMPIEAGQASVQHEDTRPTA
GDPTSAQTMPEATALVMPVFPLTGLTPEELAGRREDWGEIEDCYPLSPMQEGMLFHTLMN
PGSGIYLMQQFYAWEGRLDREAFGRAWQRVIDRHPMLRTSFMWKDLQAPLQVVHRRVAAE
DVIQDLDWADMSDEQQPIRMGEMLEQELKEGLDFEQAPLMRIRLVRRGHDRYAIVRSFHH
ILTDDWCFSLLMMDFLAHYDACIQWRTLALPPPPPYRDYIAWLQRQDQAAAEQFWKQELA
GFTTPTPLGIERLDPDTSASGSEVRDEFMELSPEVSARLRTLAQQHHVTPNTFVQGAWAI
LLSRYSGEAQVLFGVTVAGRPTDLPGVEDIVGLFINTLPLRVTLSPDLPVMTWLQHLLAE
NYRIRQYEYAPLVRIQQWSEIPSGQALFRSLLVFENAPKDARLGEERDDRALSYDQDRVH
TNYPMTVVGYPGESMGVRLSYDRRLFERAEVARMLEHLKRLLTAMAASPEASIQDLPMLD
EAERHRLLVEWNGRDRSEPAAADFSTRFETQVRRTSEAVAVECGDDRLTYDELNRSANRI
AHGLRRRGVGTDGIVALLDDRGPALLSMIVGVLKAGGAYLPLDPHHPGERLAEILASARV
KAVIFGNRQAALAETVATMLPAGVGPDFVSVENFERDAQGECNLTPVTAQQRLAYVIFTS
GSTGVPKGAMVETRGMMNHLLTKIPTLALGPADVVAQTASQCFDISVWQFLTPLLCGAKV
QIIPDEVVRDPQRLLAEVSVRGVSVLEVVPSLLGGLLEGPSSPLPRLRWLLPTGEALSPD
LSRRWFARYPTVPLVNAYGPAECSDDVALACIREQPAEAEFRMPIGRPIEGVQLYVLDRR
LDLMPAGVAGELYVGGVAVGRGYLSDPAKTAASFVPDPFSSRPGSRLYRTGDLARHRPDG
ALEFVGRRDHQVKIRGFRIELGEIEARLAQHPEVDRCVVVVAESRPGHKQLVAYVATTAT
VNADRLRLFLRRTLPEYMVPATFLFLHSLPLTPNGKIDRKALPAPDADRLADDFEPPATP
TQDLVAGIWGEILGLERIGRRDQFFELGGHSLLATQVMSRVRTAFRIELPLRTLFDHPTV
EAFASAIDRAGLEGESGQIPPLVPVPRTDHLPLSFAQQRLWFLTQMDPESGAYNLPFALR
LGGALNHPILERSFLALVRRHETLRTTFPAVDGEPRQVVVEVDRFAIPVEDLTALSESER
GTAIGRHAGAQAQRPFHLDRDLPIRALLLRVSADAHILLVTVHHIAADAWSLAVVTHEVA
TIYNALANENDGAGIQSGDEPEALLPVLPVQYRDFAAWQRQWLQGALLEREIGYWKQRLG
STPPQLMLPTDHARPERQSYRGGRLTFHVPGEILEPLRRVSRRQGVTLFMTLLAAFKLLL
SKLSGQTDILVGTDVANRNRAETEQLVGFFVNLLPLRTDLSGNPSFVQLLGRVRETALGA
YAHQDVPFEKIVDSLKLTRDLGRNPLVQVLFVLQNVPPPSLQLAGVNVESLEFEHEVSRF
DVGLFMEETEDGCAGLWKFSRDLFESQTIAGWTQRFLRLLQQIGCSPECGIETLEMDDAE
VKEARRMDTKQRNDERLQRFKAIKPKPVALAQRTLVSGRPLVDGRAMPWLYTPAVDDVDL
AGWVLEQRSRLRRELLQSGALLFRGFAMKTVQDFESVAQAFCGELFGEYGDLPREKSGRH
VYGSTPYPPDKPILFHNESSHMHRWPQKQFFFCLQAAQEGGQTPIVDGRLMFKGLRPDLR
DRLREKQLMYVRNFVPGVDVSWQDLFRTSDKAEVEALCARNGMDWQWLEKDGLRTKQVCP
AIIEHPDTGESVFFNQIQLHHVSCLEPAVRDSLLSMLGIDSLPRNVYYGDGTQLEDEVVE
EIGLLYEQTAVRFPWQEGDLIMLDNMLVAHARDPFVGPRKIVVAMGDMIAQSAVHSMTS
Download sequence
Identical sequences D8PF72
gi|302037484|ref|YP_003797806.1| WP_013248702.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]