SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302037485|ref|YP_003797807.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302037485|ref|YP_003797807.1|
Domain Number 1 Region: 426-983
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 2.09e-160
Family Acetyl-CoA synthetase-like 0.0000000188
Further Details:      
 
Domain Number 2 Region: 1486-2053
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 7.98e-156
Family Acetyl-CoA synthetase-like 0.000000082
Further Details:      
 
Domain Number 3 Region: 1247-1492
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 9.45e-61
Family NRPS condensation domain (amide synthase) 0.047
Further Details:      
 
Domain Number 4 Region: 1062-1239
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2e-51
Family NRPS condensation domain (amide synthase) 0.0043
Further Details:      
 
Domain Number 5 Region: 2107-2372
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 9.83e-40
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.017
Further Details:      
 
Domain Number 6 Region: 191-426
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.67e-23
Family NRPS condensation domain (amide synthase) 0.052
Further Details:      
 
Domain Number 7 Region: 10-182
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 4.45e-23
Family NRPS condensation domain (amide synthase) 0.024
Further Details:      
 
Domain Number 8 Region: 964-1036
Classification Level Classification E-value
Superfamily ACP-like 7.72e-21
Family Peptidyl carrier domain 0.0016
Further Details:      
 
Domain Number 9 Region: 2032-2106
Classification Level Classification E-value
Superfamily ACP-like 5.1e-20
Family Peptidyl carrier domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302037485|ref|YP_003797807.1|
Sequence length 2392
Comment putative multi-domain non-ribosomal peptide synthetase [Candidatus Nitrospira defluvii]
Sequence
MHQDIEIEGLRLSPHQKRLWLWQSRGHVGQARALFKLDGVFDDEAVQKALAHTIARHDSL
RTTFYREPGMKVPFQVINEESDVLWRRVDLRHLPDERDREQAANEAAHRTDDRDWEARPL
VRATLYRLTDDHARLVLDLPGLCADTCSLSNMAIELGRLLDGDDGGWEGEAPVQYSQFSE
WHHDLLEGAEADQGRAWWARRRPTGDQAVPLPFEQAGRPEGREPAARPVHRICSAMETEG
LRGAAATAQVSLPVLLYACWSALLYRLTSRRDLICWWRTDGRPYEELQGGIGLFERWLPL
HLRIEGNMALQDLLALAAREHGQAEDWQHYYPAEQDDEEAVAVREGIGFEYGRRAKPNRT
VAGVITLAGSTFCAEPFKLRLACLEDEADLALTWHIDGERIPSEMVQSLADRYVELLRTI
PGRLAVAIDDLDIVGTRERIRLTRELNQTARPLDSCLPMHRLIEAQAARRPSFPALVAGE
RRLSYDDLNRQANRVAHGLRRRGVQPGDRVGLCLDRSADMIVAMLGVLKAGAAYVPVDPA
HAAVRLAPQMAHSGARLLVTQGGSAQARPVFDGVILDIREAVAHEPDGNLDLAFSPDDLA
YVIYTSGSTGQPKGVAVSHRNLANYTLAISRQLDLREPFHFATVSTLSADLGHTAIFPAL
TSGGCLHVIGYETATDGRLFASYLQEHPIDVLKIVPSHFKALMATGDGQALWPRRFLLFG
GEALSWDLVEQVRRQAACIVVNHYGPTETTVGALTTVVTDNKGVRLARTVPIGRPIDNLE
AYILDARQEPVPVGAAGELYLGGAGVARGYWEQPERTAERFLPHPHASQPGARLYRTGDL
ARRLPDGSIEFLGRADHQVKIRGFRIELGEIESVLRRHPAVQDAVVMAREDGNAELYLAA
YLVARTTEPDRQAIQDFLRSHLPDYMVPTAVTSLPALPLTANGKVDRRALPEPDREGGGT
SRFVAPGSVTEEILAAIWSEVLKREGIGIHDNFFDLGGHSLLATQVMSRLRQAFRVDLPL
RTVFESPDIAQLAGVIDATKGIAGGDQPPPIQPRLRTGSLPLSFAQERLWVLAQLDPEGV
AYNIPIALRVTGPLDVTALERSFNEVVRRHESLRTTFQSLNGVPVQVVASSLRLPVTVID
LQHLPVEARDQAAVRLAGVESQRPFDLRYGPLLRVSLIRLQPNEHVLLLTLHHIVSDAWS
AHVLVKEVTALYDAFAAGRASSLPDLPLQYGDFSQWQRAWLSGTVLKRELEFWRTSLGGD
LPVMELPTDRPRPALQTSRGAMAGATIPAELSAEVAALSRRMGATLYMTLLSAFFILLTR
MTGQTDLIVGTPIANRTRKETEGLIGFFVNTLAIRTKVFGHSSMADVLANVREACLDAYA
HQDMPFEKLVDALQPKRDVSRSPVFQVMFDLQNAPVSELNIHGLEFQPIEIETTTAKFDL
SMTVQDQDGRLLVAMEYNSDLFEAATIERLLDRYQQVLAGMTGDIRTGIGSIHLLTAQER
QAVLAVNRTHASSEPSQSLPALIERRAAQTPDAPALVLQDHVMSYRDLNDKSNRLARWLR
KRGVEPERRVGISMERSFDMVVALLGIMKAGGVYVPIDPTYPAGRQHNLVVDAGVDLILR
HGTAMPEADSFPVPVLSLDRLNAELDTVSGENLDRPISMEQAAYVIYTSGSTGTPKGVVV
FHRALCQHLMAAAAAYELSPADRVLQFAAVSFDVASEEVWTTLISGAAVVLQPCRLFDSI
PAFLDFLDRQRVTVAGLPASYWHQWVDAFEQADCSVPSRVRLLIVGNEPVASSDLKRWRR
RVGRNVRWLNAYGPTEATITASLYDPSLSGEELALHTVPIGRPLPGRSMYVLDRHLEPVP
FDVPGEVYIGGETLARGYLADPERTAGLFIPDPFGGRPGARLYRTGDRALVRSDGTIEFH
GRFDDQVKLRGFRIEPGEIEERLRRHPDVRTGLVVPRDDAEGRTRLVAYVVVREDAQFDE
PDLRRWLASTLPDYMVPFLMLPLTELPRTPGGKVDRGALPTPDWSGVSRQSYVAPATPLQ
RQLAAMWSEVLGVGRIGLHDNFFDVGGHSLLAVQLIARIQNVVDGPLALMELFQFPTLAT
LAEHLEGERRDLSPEILLLREGGHAPPLFCFDPTGTHVQAYRPLALSMANERPVYGLSLS
HLFTMRWQDVTVQQLAEQQARLIRERQPKGPYHLLGWSNGGVLALAVARLLERAGESVAF
LGLLDTQPDQAVSAADDSTPVEELVRYIRRDRKGDFESIPQQERESLQQRLTTLADDERL
EYAIQWARERNFLSDEEAQASIGSLKLGYALAREAARFLTVTRSSPVQASIHVWWTTSTL
ARHGKGPVDWSAHTTGVVSVDTVVGDHVDAVHSIDVHQRIGDKLAGLRAPSA
Download sequence
Identical sequences D8PF73
WP_013248703.1.3676 gi|302037485|ref|YP_003797807.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]