SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302037520|ref|YP_003797842.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302037520|ref|YP_003797842.1|
Domain Number 1 Region: 10-205
Classification Level Classification E-value
Superfamily SGNH hydrolase 3.52e-34
Family TAP-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302037520|ref|YP_003797842.1|
Sequence length 223
Comment hypothetical protein NIDE2201 [Candidatus Nitrospira defluvii]
Sequence
MTASIQLPLIVCFGDSLTAGYQTPGPANAYERETPYGHVLQECLGHRGRVEISGICGEVT
GEMVLRFRGAVLDRKPQMVIILGGTNDLGWNADPAEIMRNLVKMYESARAASIIPVPVTV
PSIRVDVGTDNPDAAAWLAGHLQRRQQLNHLIADYAGRKGLFCFDLFTATADPDSLMLAE
PYSNDGLHLTTSGYRLFGRRLYEQLFAPTATGSLLTPFRPSGP
Download sequence
Identical sequences D8PFA8
WP_013248738.1.3676 gi|302037520|ref|YP_003797842.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]