SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302037745|ref|YP_003798067.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|302037745|ref|YP_003798067.1|
Domain Number - Region: 9-91
Classification Level Classification E-value
Superfamily GckA/TtuD-like 0.0432
Family GckA/TtuD-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302037745|ref|YP_003798067.1|
Sequence length 227
Comment hypothetical protein NIDE2432 [Candidatus Nitrospira defluvii]
Sequence
MTRFSPTVRLLLLGLGLTMAACAASPAPRLVYKDATTLVQVQHDVHAESGNSHPARLSVP
TIKQVLTGVRVQKRGDIVLSLVTGETEAVPAFSNAEIEDLAPRISQALATATPTELVGFY
RRVSDSGLGLGVTSGGILVRDGLLYVVLANHRSRFSDAMREGLSYEVDPVRDPLLSLRSR
AFKVSFVTDRAVAHPVKAWDYIDSGKLVVLEIQTLESLFQPTPASQR
Download sequence
Identical sequences D8PFV5
WP_013248963.1.3676 gi|302037745|ref|YP_003798067.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]