SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302037753|ref|YP_003798075.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302037753|ref|YP_003798075.1|
Domain Number 1 Region: 200-565
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 5.95e-84
Family Bacterial glucoamylase C-terminal domain-like 0.06
Further Details:      
 
Domain Number 2 Region: 8-138
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.64e-34
Family Thioltransferase 0.024
Further Details:      
 
Domain Number 3 Region: 744-824,855-1020
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 1.44e-28
Family Aldo-keto reductases (NADP) 0.00098
Further Details:      
 
Weak hits

Sequence:  gi|302037753|ref|YP_003798075.1|
Domain Number - Region: 1177-1225
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 0.00605
Family Aldo-keto reductases (NADP) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302037753|ref|YP_003798075.1|
Sequence length 1236
Comment hypothetical protein NIDE2440 [Candidatus Nitrospira defluvii]
Sequence
MTSTTPGREPNRLIRQTSPYLLQHAYNPVDWYPWGPEALAQAAKLNRPILLSIGYSSCHW
CHVMERESFENEAIARLMNHHFVCIKVDREERPDLDEIYMQATLALNRNQGGWPMTVFLT
PDQKPFFAGTYFPPEDRWGRPGFPTLLKKIAEYWEKDHAGVVAQAATLTARLQDGSHAPS
PTTVGEAELDMAVTQFAEDFDAKLGGFGGAPKFPPATGLSLLLHCYHRTKDPQTLTMVRT
TLDAMAAGGIYDQIGDGFARYSTDDRWLVPHFEKMLYDNALLARVYVEAFQVTADPNYRR
VACETLDYILKEMTSPEGGFYSATDADSEGVEGKFFVWTPDEIRAVLSNEEDVRRICTYY
DVTPAGNWEHKNVLHTAKPVASVAKELGLTVEDLQATIDRVKPLLYAARAKRVPPGLDDK
VITAWNGMMISAMAEAGRVFDMPRYRAAAERACEFLLTTLSKPDGRLLRTYRAGTAHLDA
YLEDYAYFAEGLIDTYEAGGHERYLSAAVRLAERILADFSDGQQGGFFTTATGHEALIVR
SREGPDGATPSGNAVAAAALARLSYHFGREDFRQAAAGAVRAYGRQIARYPRAFAKSLIV
VDLLTSGPVEIAVIGAPDDSNTVALRAAVSRTYIPNRVIASRESQQSEPTHPLLHGKALV
GGKSALYVCRNFACRRPITDPADLPTQLDPSHKAAPPLTASEQKVLSGNVYPGAATVQGT
AGYAARKIHDATGAGSLANGFGPFGATGLTVSRLGFGTYRVGQREAEHREALIKALRSGC
NLIDTSTNYMDGESEQVVGSVLQQLIRAGEVAREEIIVVSKIGYVQGQNLAQAKTREKSG
KPYPDMVKYGDDIWHCIHPEFLADQLTLSLDRLGLATLDVCLLHNPEYFLSHATRLGAGE
QRDLSRLRDELYVRMQLAFEYCERQVESGRLRGYGVSSNTSTASPDESGATSLSRMIEAA
KAAARKVGASAHHFTVLQCPMNLHESGAALIKNTGPDNGSTLLAEAVKEGVAVLVNRPLN
AMPAQRGGVVRLADVPVPAPAPAPEAEFETQRQKVALLEEAYRKDLAPAVAHSGQGMLPA
DFFRWADELNRIRTQVQGLEHWEQIETQMIAPHVNQVLRALSEALTGPIAEQWEAWRDRY
VPELLALLRTLHREASERSRLRAEDLHRTIDPLLPEQRRKATLSQKALWILASTGGVTSV
LNGMRTPAYVDDALQILRWEPLSDSRRVYECCAEKK
Download sequence
Identical sequences D8PFW3
WP_013248971.1.3676 gi|302037753|ref|YP_003798075.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]