SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302037780|ref|YP_003798102.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302037780|ref|YP_003798102.1|
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.96e-19
Family eIF5a N-terminal domain-like 0.0034
Further Details:      
 
Domain Number 2 Region: 128-185
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.06e-16
Family Cold shock DNA-binding domain-like 0.0005
Further Details:      
 
Domain Number 3 Region: 65-129
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000356
Family Cold shock DNA-binding domain-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302037780|ref|YP_003798102.1|
Sequence length 186
Comment elongation factor P [Candidatus Nitrospira defluvii]
Sequence
MISTAEFRNGSPLMVEGQPFYIVEFQHVKPGKGGAFVRTKLKSYLSGNVLDRTFRSGEKF
DTPQIEECDMQFLYATNDSYTFMDTETYEQSTYEKSQLGSNADLLKENMIAKILIYEHRP
ITVLLPNFIELKVVDGEPGVRGDTASGGNKPVIVETGATIKVPLYLEIGETIRIDTRTRE
FVERVR
Download sequence
Identical sequences A0A1W1HN93 D8PFZ0
gi|302037780|ref|YP_003798102.1| WP_013248998.1.3676 WP_013248998.1.96234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]