SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302037802|ref|YP_003798124.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|302037802|ref|YP_003798124.1|
Domain Number - Region: 29-137
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00765
Family Fibronectin type III 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302037802|ref|YP_003798124.1|
Sequence length 415
Comment hypothetical protein NIDE2489 [Candidatus Nitrospira defluvii]
Sequence
MSRRQPRLRILFLAIAMLACLPSFVSAQTPPQRLRVIDTPSDGGGSLTVLWAPSASDSAA
WKYQILLHEGSVPSDPSAWKIVAEFPANTRYVREGKTAWWTRSGDPGDHIFLLKNGKGIE
LKATQSYAVTVAAVNGQERFIALPLVASPEPNWMNWNQVNNLVLALMFGGIVFYAINLAK
RKEIFLRRIPGLDAVDEAIGRATELGKPILYMTGAHDMNDPSTIAAAVILGRVAKKAAAY
ETELLVPHREPITMAVCQEITKQAYMEAGKPDLFKEDANFFITSDQFSYTAAVDGIMLRR
KPAANFFMGSYFAESLLLTETGASTGAIQIAGTDSDHQLPFFVTTCDYTLIGEELYAASA
YLSKEPIQIGTLRGQDLGKAFVLGVIGVGTLLATLAVITGNNWAQPLLDLFKDLK
Download sequence
Identical sequences D8PG12
WP_013249020.1.3676 gi|302037802|ref|YP_003798124.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]